Red abalone lysin F104A
GRSWHYVEPK FLNKAFEVAL KVQIIAGFDR GLVKWLRVHG RTLSTVQKKA LYFVNRRYMQ THWANYMLWI NKKIDALGRT PVVGDYTRLG AEIGRRIDMA YFYDALKDKN MIPKYLPYME EINRMRPADV PVKYM
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 68.7 % (1167 of 1698) | 64.5 % (574 of 890) | 70.4 % (469 of 666) | 87.3 % (124 of 142) |
Backbone | 89.1 % (711 of 798) | 86.8 % (236 of 272) | 90.2 % (358 of 397) | 90.7 % (117 of 129) |
Sidechain | 55.8 % (573 of 1027) | 54.7 % (338 of 618) | 57.8 % (229 of 396) | 46.2 % (6 of 13) |
Aromatic | 33.2 % (63 of 190) | 42.1 % (40 of 95) | 20.9 % (19 of 91) | 100.0 % (4 of 4) |
Methyl | 82.0 % (123 of 150) | 82.7 % (62 of 75) | 81.3 % (61 of 75) |
1. entity 1
GRSWHYVEPK FLNKAFEVAL KVQIIAGFDR GLVKWLRVHG RTLSTVQKKA LYFVNRRYMQ THWANYMLWI NKKIDALGRT PVVGDYTRLG AEIGRRIDMA YFYDALKDKN MIPKYLPYME EINRMRPADV PVKYMSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 200 mM natural abundunce sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lysin | [U-15N] | 300 uM | |
2 | sodium chloride | natural abundunce | 200 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 5 w/v c12e6/hexanol, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | c12e6/hexanol | natural abundance | 5 w/v | |
8 | lysin | [U-15N] | 300 uM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | sodium phosphate | natural abundance | 10 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 200 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM Tris, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Tris | natural abundance | 10 mM | |
12 | lysin | [U-13C; U-15N] | 200 uM | |
13 | sodium chloride | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 200 mM natural abundunce sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lysin | [U-15N] | 300 uM | |
2 | sodium chloride | natural abundunce | 200 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 200 mM natural abundunce sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lysin | [U-15N] | 300 uM | |
2 | sodium chloride | natural abundunce | 200 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 200 mM natural abundunce sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lysin | [U-15N] | 300 uM | |
2 | sodium chloride | natural abundunce | 200 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 200 mM natural abundunce sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lysin | [U-15N] | 300 uM | |
2 | sodium chloride | natural abundunce | 200 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 200 mM natural abundunce sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lysin | [U-15N] | 300 uM | |
2 | sodium chloride | natural abundunce | 200 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 200 mM natural abundunce sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lysin | [U-15N] | 300 uM | |
2 | sodium chloride | natural abundunce | 200 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State anisotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-15N] lysin, 5 w/v c12e6/hexanol, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | c12e6/hexanol | natural abundance | 5 w/v | |
8 | lysin | [U-15N] | 300 uM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE - 600 MHz Cryo Probe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 300 uM [U-13C; U-15N] lysin, 200 mM sodium chloride, 10 mM sodium phosphate, 93% H2O/7% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | lysin | [U-13C; U-15N] | 300 uM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_30246_5utg.nef |
Input source #2: Coordindates | 5utg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GRSWHYVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRSWHYVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------110-------120-------130---- YFYDALKDKNMIPKYLPYMEEINRMRPADVPVKYM ||||||||||||||||||||||||||||||||||| YFYDALKDKNMIPKYLPYMEEINRMRPADVPVKYM -------110-------120-------130-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 135 | 0 | 0 | 100.0 |
Content subtype: combined_30246_5utg.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GRSWHYVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMA | ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || ...W.YVEPKFL.KAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRI.MA 0-------110-------120-------130---- YFYDALKDKNMIPKYLPYMEEINRMRPADVPVKYM |||||||||||||||| |||||||||||||||||| YFYDALKDKNMIPKYL.YMEEINRMRPADVPVKYM
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
109 | ASN | CG | 178.685 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 890 | 534 | 60.0 |
13C chemical shifts | 666 | 453 | 68.0 |
15N chemical shifts | 154 | 119 | 77.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 272 | 225 | 82.7 |
13C chemical shifts | 270 | 234 | 86.7 |
15N chemical shifts | 129 | 114 | 88.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 618 | 309 | 50.0 |
13C chemical shifts | 396 | 219 | 55.3 |
15N chemical shifts | 25 | 5 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 64 | 78.0 |
13C chemical shifts | 82 | 64 | 78.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 36 | 37.9 |
13C chemical shifts | 91 | 19 | 20.9 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GRSWHYVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMA | |||| ||||||||||||||||||||||||||||| ||||||| ||||||||| ||||||||||||||| ||||| ||||||||||||| | ...W..VEPK....AFEVALKVQIIAGFDRGLVKWLRVHGRTL.TVQKKAL.FVNRRYMQT.WANYMLWINKKIDAL.RTPVV.DYTRLGAEIGRRI..A 0-------110-------120-------130---- YFYDALKDKNMIPKYLPYMEEINRMRPADVPVKYM |||||||||||| ||| |||||||| ||||| || YFYDALKDKNMI.KYL.YMEEINRM..ADVPV.YM
Dihedral angle restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GRSWHYVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....YVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMA 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120-------130---- YFYDALKDKNMIPKYLPYMEEINRMRPADVPVKYM |||||||||||||||||||||||||||||||||| YFYDALKDKNMIPKYLPYMEEINRMRPADVPVKY 0-------110-------120-------130---
RDC restraints