In response to the declaration of global pandemic of Coronavirus infectious disease 2019 (COVID-19) caused by Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), we provide comprehensive content on Coronavirus molecular structures and its interactions:
SARS-unique fold in the Rousettus Bat Coronavirus HKU9
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.5 % (850 of 890) | 96.2 % (435 of 452) | 93.8 % (333 of 355) | 98.8 % (82 of 83) |
Backbone | 98.3 % (454 of 462) | 98.7 % (155 of 157) | 97.8 % (223 of 228) | 98.7 % (76 of 77) |
Sidechain | 93.4 % (469 of 502) | 94.9 % (280 of 295) | 91.0 % (183 of 201) | 100.0 % (6 of 6) |
Aromatic | 83.3 % (65 of 78) | 100.0 % (39 of 39) | 65.8 % (25 of 38) | 100.0 % (1 of 1) |
Methyl | 99.1 % (107 of 108) | 98.1 % (53 of 54) | 100.0 % (54 of 54) |
1. entity 1
SHMTAVQDFV VDILLNGARD WDVLQTTCTV DRKVYKTICK RGNTYLCFDD TNLYAITGDV VLKFATVSKA RAYLETKSolvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 637 uM [U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
5 | HKU9 NSP3 C domain | [U-15N] | 637 (±0.1) uM | |
6 | sodium azide | natural abundance | 0.02 (±0.01) % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 700 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 700 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 637 uM [U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
5 | HKU9 NSP3 C domain | [U-15N] | 637 (±0.1) uM | |
6 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 700 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 700 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 700 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 97% H2O/3% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6, Details 1.2 mM [U-13C; U-15N] HKU9 NSP3 C domain, 5 mM [U-98% 2H] DTT, 0.02 % sodium azide, 97% H2O/3% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | [U-98% 2H] | 5 (±0.01) mM | |
2 | HKU9 NSP3 C domain | [U-13C; U-15N] | 1.2 (±0.1) mM | |
3 | sodium azide | natural abundance | 0.02 (±0.01) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30247_5utv.nef |
Input source #2: Coordindates | 5utv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------- SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 77 | 0 | 0 | 100.0 |
Content subtype: combined_30247_5utv.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------- SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 355 | 332 | 93.5 |
1H chemical shifts | 452 | 431 | 95.4 |
15N chemical shifts | 87 | 83 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 154 | 150 | 97.4 |
1H chemical shifts | 157 | 155 | 98.7 |
15N chemical shifts | 77 | 76 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 201 | 182 | 90.5 |
1H chemical shifts | 295 | 276 | 93.6 |
15N chemical shifts | 10 | 7 | 70.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 55 | 54 | 98.2 |
1H chemical shifts | 55 | 53 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 38 | 24 | 63.2 |
1H chemical shifts | 39 | 39 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------- SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .HMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------- SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK
--------10--------20--------30--------40--------50--------60--------70------- SHMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITGDVVLKFATVSKARAYLETK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .HMTAVQDFVVDILLNGARDWDVLQTTCTVDRKVYKTICKRGNTYLCFDDTNLYAITG.VVLKFATVSKARAYLETK