NMR Assignment and Structure of Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)155
MSEDSATVAV TDDSFSTDVL GSSKPVLVDF WATWCGPCKM VAPVLEEIAA EKGDQLTVAK IDVDANPATA RDFQVVSIPT MILFKDGAPV KRIVGAKGKA ALLRELSDAL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.8 % (1073 of 1209) | 84.4 % (520 of 616) | 92.6 % (448 of 484) | 96.3 % (105 of 109) |
Backbone | 98.8 % (640 of 648) | 97.3 % (214 of 220) | 99.7 % (323 of 324) | 99.0 % (103 of 104) |
Sidechain | 80.8 % (537 of 665) | 77.3 % (306 of 396) | 86.7 % (229 of 264) | 40.0 % (2 of 5) |
Aromatic | 21.9 % (14 of 64) | 43.8 % (14 of 32) | 0.0 % (0 of 30) | 0.0 % (0 of 2) |
Methyl | 96.7 % (147 of 152) | 93.4 % (71 of 76) | 100.0 % (76 of 76) |
1. entity 1
MSEDSATVAV TDDSFSTDVL GSSKPVLVDF WATWCGPCKM VAPVLEEIAA EKGDQLTVAK IDVDANPATA RDFQVVSIPT MILFKDGAPV KRIVGAKGKA ALLRELSDALSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-99% 13C; U-99% 15N] Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)15513C | [U-99% 13C; U-99% 15N] | 1.1 (±0.1) mM | |
2 | NaCl | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30290_5vo7.nef |
Input source #2: Coordindates | 5vo7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA -------110 ALLRELSDAL |||||||||| ALLRELSDAL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
Content subtype: combined_30290_5vo7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA -------110 ALLRELSDAL |||||||||| ALLRELSDAL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
55 | GLN | CD | 180.072 |
74 | GLN | CD | 180.929 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 616 | 523 | 84.9 |
13C chemical shifts | 484 | 446 | 92.1 |
15N chemical shifts | 112 | 105 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 220 | 219 | 99.5 |
13C chemical shifts | 220 | 220 | 100.0 |
15N chemical shifts | 104 | 103 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 396 | 304 | 76.8 |
13C chemical shifts | 264 | 226 | 85.6 |
15N chemical shifts | 8 | 2 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 69 | 87.3 |
13C chemical shifts | 79 | 75 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 14 | 43.8 |
13C chemical shifts | 30 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA -------110 ALLRELSDAL |||||||||| ALLRELSDAL
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA -------110 ALLRELSDAL |||||||||| ALLRELSDAL