BMRBj - BMREntryMaster

Found 1 Document (0.658 seconds)

BMRB: 30309

5W8Y

Solution Structure of XPH1, a Hybrid Sequence of Xfaso 1 and Pfl 6, Two Cro Proteins With Different Folds

Authors

Kumirov, V.K., Dykstra, E.M., Cordes, M.H.

Assembly

protein XPH1

Entity

1. protein XPH1 (polymer, Thiol state: all disulfide bound), 73 monomers, 8022.008 Da Detail

MNAIDIAINK LGSVSALAAA LGVNQSAISQ WRARGRVPAG RCIDIELYTD GRVECRELRP DVFGALEHHH HHH

Formula weight

8022.008 Da

Entity Connection

disulfide 1 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	disulfide	sing	1:CYS42:SG	1:CYS55:SG

Source organism

Xylella fastidiosa subsp. sandyi Ann-1

Exptl. method

solution NMR

Data set

assigned_chemical_shifts, spectral_peak_list

Chem. Shift Complete

Sequence coverage: 94.5 %, Completeness: 87.6 %, Completeness (bb): 92.9 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	87.6 % (708 of 808)	91.6 % (381 of 416)	81.0 % (255 of 315)	93.5 % (72 of 77)
Backbone	92.9 % (403 of 434)	94.0 % (141 of 150)	92.0 % (196 of 213)	93.0 % (66 of 71)
Sidechain	83.0 % (366 of 441)	90.2 % (240 of 266)	71.0 % (120 of 169)	100.0 % (6 of 6)
Aromatic	44.4 % (24 of 54)	44.4 % (12 of 27)	42.3 % (11 of 26)	100.0 % (1 of 1)
Methyl	100.0 % (90 of 90)	100.0 % (45 of 45)	100.0 % (45 of 45)

1. entity 1

MNAIDIAINK LGSVSALAAA LGVNQSAISQ WRARGRVPAG RCIDIELYTD GRVECRELRP DVFGALEHHH HHH

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 0.4 mM [U-13C; U-15N] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	DSS	natural abundance	0.1 mM
2	XPH1	[U-13C; U-15N]	0.4 mM
3	potassium chloride	natural abundance	150 mM
4	potassium phosphate	natural abundance	50 mM
5	sodium azide	natural abundance	0.01 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 0.4 mM [U-13C; U-15N] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 100% D2O

#	Name	Isotope labeling	Concentration
6	DSS	natural abundance	0.1 mM
7	XPH1	[U-13C; U-15N]	0.4 mM
8	potassium chloride	natural abundance	150 mM
9	potassium phosphate	natural abundance	50 mM
10	sodium azide	natural abundance	0.01 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 0.6 mM [U-13C; U-15N] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
11	DSS	natural abundance	0.1 mM
12	XPH1	[U-13C; U-15N]	0.6 mM
13	potassium chloride	natural abundance	150 mM
14	potassium phosphate	natural abundance	50 mM
15	sodium azide	natural abundance	0.01 %

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.8 mM [U-10% 13C] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
16	DSS	natural abundance	0.1 mM
17	XPH1	[U-10% 13C]	1.8 mM
18	potassium chloride	natural abundance	150 mM
19	potassium phosphate	natural abundance	50 mM
20	sodium azide	natural abundance	0.01 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.18 ppm, Outliers: 3 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.18 ppm, Outliers: 3 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: 0.05 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.14 ppm, Outliers: 1 Detail

Release date

2017-08-13

Citation

Multistep mutational transformation of a protein fold through structural intermediates
Kumirov, V.K., Dykstra, E.M., Hall, B.M., Anderson, W.J., Szyszka, T.N., Cordes, M.H.
Protein Sci. (2018), 27, 1767-1779, PubMed 30051937 , DOI 10.1002/pro.3488 , Abstract

Related entities 1. protein XPH1, : 1 : 1 entities Detail

Experiments performed 8 experiments Detail

1 3D_15N-separated_NOESY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 0.6 mM [U-13C; U-15N] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
11	DSS	natural abundance	0.1 mM
12	XPH1	[U-13C; U-15N]	0.6 mM
13	potassium chloride	natural abundance	150 mM
14	potassium phosphate	natural abundance	50 mM
15	sodium azide	natural abundance	0.01 %

2 3D_13C-separated_NOESY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 0.4 mM [U-13C; U-15N] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 100% D2O

#	Name	Isotope labeling	Concentration
6	DSS	natural abundance	0.1 mM
7	XPH1	[U-13C; U-15N]	0.4 mM
8	potassium chloride	natural abundance	150 mM
9	potassium phosphate	natural abundance	50 mM
10	sodium azide	natural abundance	0.01 %

3 3D HNCO

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 0.4 mM [U-13C; U-15N] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	DSS	natural abundance	0.1 mM
2	XPH1	[U-13C; U-15N]	0.4 mM
3	potassium chloride	natural abundance	150 mM
4	potassium phosphate	natural abundance	50 mM
5	sodium azide	natural abundance	0.01 %

4 3D HNCACB

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	DSS	natural abundance	0.1 mM
2	XPH1	[U-13C; U-15N]	0.4 mM
3	potassium chloride	natural abundance	150 mM
4	potassium phosphate	natural abundance	50 mM
5	sodium azide	natural abundance	0.01 %

5 3D CBCA(CO)NH

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	DSS	natural abundance	0.1 mM
2	XPH1	[U-13C; U-15N]	0.4 mM
3	potassium chloride	natural abundance	150 mM
4	potassium phosphate	natural abundance	50 mM
5	sodium azide	natural abundance	0.01 %

6 3D HCCH-TOCSY

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	DSS	natural abundance	0.1 mM
2	XPH1	[U-13C; U-15N]	0.4 mM
3	potassium chloride	natural abundance	150 mM
4	potassium phosphate	natural abundance	50 mM
5	sodium azide	natural abundance	0.01 %

7 2D 1H-13C HSQC aliphatic

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.8 mM [U-10% 13C] XPH1, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
16	DSS	natural abundance	0.1 mM
17	XPH1	[U-10% 13C]	1.8 mM
18	potassium chloride	natural abundance	150 mM
19	potassium phosphate	natural abundance	50 mM
20	sodium azide	natural abundance	0.01 %

8 2D 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
11	DSS	natural abundance	0.1 mM
12	XPH1	[U-13C; U-15N]	0.6 mM
13	potassium chloride	natural abundance	150 mM
14	potassium phosphate	natural abundance	50 mM
15	sodium azide	natural abundance	0.01 %

NMR combined restraints 8 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_30309_5w8y.nef
Input source #2: Coordindates	5w8y.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	True (see coordinates for details)
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
A:42:CYS:SG	A:55:CYS:SG	oxidized, CA 60.161, CB 36.523 ppm	oxidized, CA 56.849, CB 39.096 ppm	2.022

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70---
MNAIDIAINKLGSVSALAAALGVNQSAISQWRARGRVPAGRCIDIELYTDGRVECRELRPDVFGALEHHHHHH
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MNAIDIAINKLGSVSALAAALGVNQSAISQWRARGRVPAGRCIDIELYTDGRVECRELRPDVFGALEHHHHHH

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	73	0	0	100.0

Content subtype: combined_30309_5w8y.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	1		No information
1	Assigned chemical shifts	assigned_chemical_shifts_1	Warning	713		94.5 (chain: A, length: 73)
1	Distance restraints	CNS/XPLOR_distance_constraints_4	OK	289 (1)	noe	87.7 (chain: A, length: 73)
2	Distance restraints	DYANA/DIANA_distance_constraints_7	OK	803 (1)	noe	89.0 (chain: A, length: 73)
3	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	42 (1)	hbond	50.7 (chain: A, length: 73)
4	Distance restraints	DYANA/DIANA_distance_constraints_5	OK	42 (1)	hbond	50.7 (chain: A, length: 73)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_2	OK	120 (120)	.	82.2 (chain: A, length: 73)
2	Dihedral angle restraints	DYANA/DIANA_dihedral_6	OK	120 (120)	.	82.2 (chain: A, length: 73)

Assigned chemical shifts

Saveframe: assigned_chemical_shifts_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 73, Sequence coverage: 94.5%
- Total number of assignments
  - ¹H chemical shifts: 381
  - ¹³C chemical shifts: 255
  - ¹⁵N chemical shifts: 77
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	416	381	91.6
¹³C chemical shifts	315	255	81.0
¹⁵N chemical shifts	84	77	91.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	150	141	94.0
¹³C chemical shifts	146	135	92.5
¹⁵N chemical shifts	71	66	93.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	266	240	90.2
¹³C chemical shifts	169	120	71.0
¹⁵N chemical shifts	13	11	84.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	46	46	100.0
¹³C chemical shifts	46	46	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	27	12	44.4
¹³C chemical shifts	26	11	42.3
¹⁵N chemical shifts	1	1	100.0

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_4
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 73, Sequence coverage: 87.7%
- Total number of restraints: 289
- Weight of restraints: 1.0 (289)
- Potential type of restraints: square-well-parabolic (289)
- Range of distance target values: 1.38, 3.0 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_7
  - Status: OK
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 73, Sequence coverage: 89.0%
  - Total number of restraints: 803
  - Weight of restraints: 1.0 (803)
  - Potential type of restraints: upper-bound-parabolic (803)
  - Range of distance target values: 1.56, 6.0 (Å)
  - Histogram of distance target values
  - Histogram of discrepancy in distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map
  - Saveframe: CNS/XPLOR_distance_constraints_3
    - Status: OK
    - Experiment type: hbond
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 73, Sequence coverage: 50.7%
    - Total number of restraints: 42
    - Weight of restraints: 1.0 (42)
    - Potential type of restraints: square-well-parabolic (42)
    - Range of distance target values: 1.25, 1.75 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
    - Distance restraints on contact map
    - Saveframe: DYANA/DIANA_distance_constraints_5
      - Status: OK
      - Experiment type: hbond
      - Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 73, Sequence coverage: 50.7%
        --------10--------20--------30--------40--------50--------60--------70--- MNAIDIAINKLGSVSALAAALGVNQSAISQWRARGRVPAGRCIDIELYTDGRVECRELRPDVFGALEHHHHHH |||||||||| |||||||| |||||||||| ||||||||| .NAIDIAINKL..VSALAAAL...QSAISQWRAR......RCIDIELYT --------10--------20--------30--------40---------
      - Total number of restraints: 42
        Total hydrogen bond restraints: 42
        O...H-x: 21
        O...h-N: 21
      - Weight of restraints: 1.0 (42)
        Total hydrogen bond restraints: 1.0 (42)
        O...H-x: 1.0 (21)
        O...h-N: 1.0 (21)
      - Potential type of restraints: upper-bound-parabolic (42)
        Total hydrogen bond restraints: upper-bound-parabolic (42)
        O...H-x: upper-bound-parabolic (21)
        O...h-N: upper-bound-parabolic (21)
      - Range of distance target values: 2.5, 3.5 (Å)
      - Histogram of distance target values
      - Distance restraints per residue
        Chain_ID: A
      - Distance restraints on contact map
        Chain_ID_1: A - Chain_ID_2: A

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 73, Sequence coverage: 82.2%
- Total number of restraints: 120
- Total number of restraints per polymer type: 120
- Weight of restraints: 1.0 (120)
- Potential type of restraints: square-well-parabolic (120)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A
- Saveframe: DYANA/DIANA_dihedral_6
  - Status: OK
  - Experiment type: .
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 73, Sequence coverage: 82.2%
  - Total number of restraints: 120
  - Total number of restraints per polymer type: 120
  - Weight of restraints: 1.0 (120)
  - Potential type of restraints: square-well-parabolic (120)
  - Plot of Phi-Psi angle restraints
  - Dihedral angle restraints per residue
    - Chain_ID: A

Keywords conformational switch, disulfide bond, helix-turn-helix, metamorphic protein, structural evolution, transcription factor

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.658 seconds)

BMRB: 30309

Sample #1

Sample #2

Sample #3

Sample #4

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. protein XPH1, : 1 : 1 entities Detail

Experiments performed 8 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 8 contents Detail