Solution Structure and Dynamics of an Ultra-Stable Single-Chain Insulin Analog STUDIES OF AN ENGINEERED MONOMER AND IMPLICATIONS FOR RECEPTOR BINDING
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 76.9 % (500 of 650) | 73.2 % (246 of 336) | 81.4 % (206 of 253) | 78.7 % (48 of 61) |
Backbone | 83.4 % (282 of 338) | 87.2 % (102 of 117) | 83.1 % (138 of 166) | 76.4 % (42 of 55) |
Sidechain | 72.5 % (264 of 364) | 65.8 % (144 of 219) | 82.0 % (114 of 139) | 100.0 % (6 of 6) |
Aromatic | 25.8 % (17 of 66) | 9.1 % (3 of 33) | 42.4 % (14 of 33) | |
Methyl | 100.0 % (54 of 54) | 100.0 % (27 of 27) | 100.0 % (27 of 27) |
1. Insulin
FVNQHLCGSH LVEALYLVCG ERGFFYTDPT EEGPRRGIVE QCCHSICSLE QLENYCNSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1 mM [U-13C; U-15N] Single chain insulin SCI-b, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single chain insulin SCI-b | [U-13C; U-15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30314_5wbt.nef |
Input source #2: Coordindates | 5wbt.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:7:CYS:SG | A:43:CYS:SG | unknown | unknown | 2.022 |
A:19:CYS:SG | A:56:CYS:SG | unknown | unknown | 2.024 |
A:42:CYS:SG | A:47:CYS:SG | unknown | unknown | 2.025 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50------- FVNQHLCGSHLVEALYLVCGERGFFYTDPTEEGPRRGIVEQCCHSICSLEQLENYCN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FVNQHLCGSHLVEALYLVCGERGFFYTDPTEEGPRRGIVEQCCHSICSLEQLENYCN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 57 | 0 | 0 | 100.0 |
Content subtype: combined_30314_5wbt.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50------- FVNQHLCGSHLVEALYLVCGERGFFYTDPTEEGPRRGIVEQCCHSICSLEQLENYCN |||||||||||||||||||||||||||||||||||||||||||||| |||||||||| FVNQHLCGSHLVEALYLVCGERGFFYTDPTEEGPRRGIVEQCCHSI.SLEQLENYCN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 336 | 245 | 72.9 |
13C chemical shifts | 253 | 205 | 81.0 |
15N chemical shifts | 64 | 48 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 117 | 102 | 87.2 |
13C chemical shifts | 114 | 91 | 79.8 |
15N chemical shifts | 55 | 42 | 76.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 219 | 143 | 65.3 |
13C chemical shifts | 139 | 114 | 82.0 |
15N chemical shifts | 9 | 6 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 27 | 100.0 |
13C chemical shifts | 27 | 27 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 3 | 9.1 |
13C chemical shifts | 33 | 14 | 42.4 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50------- FVNQHLCGSHLVEALYLVCGERGFFYTDPTEEGPRRGIVEQCCHSICSLEQLENYCN ||||||| |||||||||||||||||||||||||||||||||||||| |||||||||| FVNQHLC.SHLVEALYLVCGERGFFYTDPTEEGPRRGIVEQCCHSI.SLEQLENYCN
Dihedral angle restraints
--------10--------20--------30--------40--------50------- FVNQHLCGSHLVEALYLVCGERGFFYTDPTEEGPRRGIVEQCCHSICSLEQLENYCN |||||||||||||||||||||||||| ||||||||||||||||||||| ...QHLCGSHLVEALYLVCGERGFFYTDP.......GIVEQCCHSICSLEQLENYCN