Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Sequence alignments

• Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30-
AFCNLRRCELSCRSLGLLGKCIGEACKCVPY
|||||||||||||||||||||||||||||||
AFCNLRRCELSCRSLGLLGKCIGEACKCVPY

Chain assignments

Content subtype: combined_30467_6d9o.nef

Assigned chemical shifts

1. Saveframe: assigned_chemical_shifts_1
   • Status: OK
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 31, Sequence coverage: 100.0%

     --------10--------20--------30-
     AFCNLRRCELSCRSLGLLGKCIGEACKCVPY
     |||||||||||||||||||||||||||||||
     AFCNLRRCELSCRSLGLLGKCIGEACKCVPY
     

   • Total number of assignments
     • ¹H chemical shifts: 177
   • Completeness of assignments
     • Entity_assemble_ID: A
       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	183	177	96.7

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	64	63	98.4

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	119	114	95.8

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	16	13	81.2

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	9	8	88.9

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: A

Covalent bonds

1. Saveframe: assembly
   • Status: OK

Dihedral angle restraints

1. Saveframe: DYANA/DIANA_dihedral_2
   • Status: OK
   • Experiment type: .
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 31, Sequence coverage: 100.0%

     --------10--------20--------30-
     AFCNLRRCELSCRSLGLLGKCIGEACKCVPY
     |||||||||||||||||||||||||||||||
     AFCNLRRCELSCRSLGLLGKCIGEACKCVPY
     

   • Total number of restraints: 285
     • Psi angle constraints: 75
     • Phi angle constraints: 75
     • Chi1 angle constraints: 75
     • Chi2 angle constraints: 36
     • Chi3 angle constraints: 15
     • Chi4 angle constraints: 6
     • Chi21 angle constraints: 3
   • Total number of restraints per polymer type: 285
     • Protein: 285
   • Weight of restraints: 1.0 (285)
     • Psi angle constraints: 1.0 (75)
     • Phi angle constraints: 1.0 (75)
     • Chi1 angle constraints: 1.0 (75)
     • Chi2 angle constraints: 1.0 (36)
     • Chi3 angle constraints: 1.0 (15)
     • Chi4 angle constraints: 1.0 (6)
     • Chi21 angle constraints: 1.0 (3)
   • Potential type of restraints: square-well-parabolic (285)
     • Psi angle constraints: square-well-parabolic (75)
     • Phi angle constraints: square-well-parabolic (75)
     • Chi1 angle constraints: square-well-parabolic (75)
     • Chi2 angle constraints: square-well-parabolic (36)
     • Chi3 angle constraints: square-well-parabolic (15)
     • Chi4 angle constraints: square-well-parabolic (6)
     • Chi21 angle constraints: square-well-parabolic (3)
   • Plot of Phi-Psi angle restraints
   • Plot of Chi1-Chi2 angle restraints
   • Dihedral angle restraints per residue
     • Chain_ID: A