NMR structure of the second qRRM2 domain of human hnRNP H
SNAMDWVLKH TGPNSPDTAN DGFVRLRGLP FGCSKEEIVQ FFSGLEIVPN GITLPVDFQG RSTGEAFVQF ASQEIAEKAL KKHKERIGHR YIEIFKSSRA EVRTH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.1 % (1001 of 1235) | 81.7 % (527 of 645) | 78.4 % (377 of 481) | 89.0 % (97 of 109) |
Backbone | 94.5 % (586 of 620) | 97.2 % (208 of 214) | 91.8 % (281 of 306) | 97.0 % (97 of 100) |
Sidechain | 70.3 % (500 of 711) | 72.4 % (312 of 431) | 69.4 % (188 of 271) | 0.0 % (0 of 9) |
Aromatic | 1.7 % (2 of 116) | 3.4 % (2 of 58) | 0.0 % (0 of 57) | 0.0 % (0 of 1) |
Methyl | 88.5 % (92 of 104) | 84.6 % (44 of 52) | 92.3 % (48 of 52) |
1. qRRM2 domain of Heterogeneous nuclear ribonucleoprotein H2
SNAMDWVLKH TGPNSPDTAN DGFVRLRGLP FGCSKEEIVQ FFSGLEIVPN GITLPVDFQG RSTGEAFVQF ASQEIAEKAL KKHKERIGHR YIEIFKSSRA EVRTHSolvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 760 mmHg, Temperature 305 K, pH 6.2, Details 1.5 mM C13_N15 qRRM2 domain of hnRNP H, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | qRRM2 domain of hnRNP H | C13_N15 | 1.5 (±0.1) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30469_6dg1.nef |
Input source #2: Coordindates | 6dg1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
90------100-------110-------120-------130-------140-------150-------160-------170-------180-------19 SNAMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNAMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0---- EVRTH ||||| EVRTH -----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 105 | 0 | 0 | 100.0 |
Content subtype: combined_30469_6dg1.nef
Assigned chemical shifts
90------100-------110-------120-------130-------140-------150-------160-------170-------180-------19 SNAMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNAMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRA 0---- EVRTH ||||| EVRTH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 645 | 521 | 80.8 |
13C chemical shifts | 481 | 380 | 79.0 |
15N chemical shifts | 116 | 97 | 83.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 210 | 98.1 |
13C chemical shifts | 210 | 192 | 91.4 |
15N chemical shifts | 100 | 97 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 431 | 311 | 72.2 |
13C chemical shifts | 271 | 188 | 69.4 |
15N chemical shifts | 16 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 48 | 90.6 |
13C chemical shifts | 53 | 50 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 0 | 0.0 |
13C chemical shifts | 57 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
Dihedral angle restraints
90------100-------110-------120-------130-------140-------150-------160-------170-------180-------19 SNAMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRA |||||| ||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............NSPDTA..GFVRLRG.PFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRA 90------100-------110-------120-------130-------140-------150-------160-------170-------180-------19 0---- EVRTH ||| EVR 0--