NMR solution structure of wild type apo hFABP1 at 308 K
HHHHHHVAMS FSGKYQLQSQ ENFEAFMKAI GLPEELIQKG KDIKGVSEIV QNGKHFKFTI TAGSKVIQNE FTVGEECELE TMTGEKVKTV VQLEGDNKLV TTFKNIKSVT ELNGDIITNT MTLGDIVFKR ISKRI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.0 % (1384 of 1610) | 91.9 % (769 of 837) | 75.5 % (472 of 625) | 96.6 % (143 of 148) |
Backbone | 82.3 % (665 of 808) | 95.0 % (266 of 280) | 68.5 % (270 of 394) | 96.3 % (129 of 134) |
Sidechain | 90.5 % (838 of 926) | 90.3 % (503 of 557) | 90.4 % (321 of 355) | 100.0 % (14 of 14) |
Aromatic | 74.1 % (86 of 116) | 75.9 % (44 of 58) | 72.4 % (42 of 58) | |
Methyl | 96.8 % (151 of 156) | 94.9 % (74 of 78) | 98.7 % (77 of 78) |
1. entity 1
HHHHHHVAMS FSGKYQLQSQ ENFEAFMKAI GLPEELIQKG KDIKGVSEIV QNGKHFKFTI TAGSKVIQNE FTVGEECELE TMTGEKVKTV VQLEGDNKLV TTFKNIKSVT ELNGDIITNT MTLGDIVFKR ISKRISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | Human liver fatty acid binding protein (hFABP1) | [U-13C; U-15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_30477_6do6.nef |
Input source #2: Coordindates | 6do6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- HHHHHHVAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HHHHHHVAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----100-------110-------120------- TTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI ||||||||||||||||||||||||||||||||||| TTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI -------110-------120-------130-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 135 | 0 | 0 | 100.0 |
Content subtype: combined_30477_6do6.nef
Assigned chemical shifts
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- HHHHHHVAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......VAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLV -----100-------110-------120------- TTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI ||||||||||||||||||||||||||||||||||| TTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 837 | 772 | 92.2 |
13C chemical shifts | 625 | 446 | 71.4 |
15N chemical shifts | 150 | 144 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 280 | 268 | 95.7 |
13C chemical shifts | 270 | 129 | 47.8 |
15N chemical shifts | 134 | 128 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 557 | 504 | 90.5 |
13C chemical shifts | 355 | 317 | 89.3 |
15N chemical shifts | 16 | 16 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 81 | 98.8 |
13C chemical shifts | 82 | 81 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 42 | 72.4 |
13C chemical shifts | 58 | 40 | 69.0 |
Distance restraints
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- HHHHHHVAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......VAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLV -----100-------110-------120------- TTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI ||||||||||||||||||||||||||||||||||| TTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI