Solution NMR Structure of the Colied-coil PALB2 Homodimer
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.4 % (649 of 838) | 83.5 % (375 of 449) | 67.0 % (215 of 321) | 86.8 % (59 of 68) |
Backbone | 71.9 % (289 of 402) | 85.9 % (116 of 135) | 57.9 % (117 of 202) | 86.2 % (56 of 65) |
Sidechain | 82.7 % (415 of 502) | 82.5 % (259 of 314) | 82.7 % (153 of 185) | 100.0 % (3 of 3) |
Aromatic | 52.0 % (26 of 50) | 52.0 % (13 of 25) | 52.0 % (13 of 25) | |
Methyl | 89.7 % (52 of 58) | 89.7 % (26 of 29) | 89.7 % (26 of 29) |
1. entity 1
MEELSGKPLS YAEKEKLKEK LAFLKKEYSR TLARLQRAKR AEKAKNSKKA IEDGVPQPEA LEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 v/v [U-100% 13C; U-100% 15N] PALB2cc, 2 v/v unlabeled PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 0.02 % sodium azide, 10 % DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | PALB2cc | [U-100% 13C; U-100% 15N] | 1 v/v | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 200 mM | |
11 | Calcium Chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | DSS | natural abundance | 10 % | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | unlabeled PALB2cc | natural abundance | 2 v/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 v/v [U-100% 13C; U-100% 15N] PALB2cc, 2 v/v unlabeled PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 0.02 % sodium azide, 10 % DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | PALB2cc | [U-100% 13C; U-100% 15N] | 1 v/v | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 200 mM | |
11 | Calcium Chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | DSS | natural abundance | 10 % | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | unlabeled PALB2cc | natural abundance | 2 v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] PALB2cc, 20 mM MES, 200 mM sodium chloride, 5 mM Calcium Chloride, 10 mM DTT, 10 % DSS, 0.02 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PALB2cc | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | Calcium Chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30493_6e4h.nef |
Input source #2: Coordindates | 6e4h.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60-------- MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH
--------10--------20--------30--------40--------50--------60-------- MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 68 | 0 | 0 | 100.0 |
B | B | 68 | 0 | 0 | 100.0 |
Content subtype: combined_30493_6e4h.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60-------- MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEA --------10--------20--------30--------40--------50--------60
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 449 | 374 | 83.3 |
13C chemical shifts | 321 | 211 | 65.7 |
15N chemical shifts | 72 | 59 | 81.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 135 | 116 | 85.9 |
13C chemical shifts | 136 | 58 | 42.6 |
15N chemical shifts | 65 | 56 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 314 | 258 | 82.2 |
13C chemical shifts | 185 | 153 | 82.7 |
15N chemical shifts | 7 | 3 | 42.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 26 | 86.7 |
13C chemical shifts | 30 | 26 | 86.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 13 | 52.0 |
13C chemical shifts | 25 | 13 | 52.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60-------- MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALE --------10--------20--------30--------40--------50--------60--
--------10--------20--------30--------40--------50--------60-------- MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALE --------10--------20--------30--------40--------50--------60--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60-------- MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH ||||||||||||||||||||||||||||||||||||||||| ||||||||||||| .....GKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKN.KKAIEDGVPQPEA --------10--------20--------30--------40--------50--------60
--------10--------20--------30--------40--------50--------60-------- MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEALEHHHHHH ||||||||||||||||||||||||||||||||||||||||| ||||||||||||| .....GKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKN.KKAIEDGVPQPEA --------10--------20--------30--------40--------50--------60