Human Obscurin Ig57 Domain
MAPEVTILEP LQDVQLSEGQ DASFQCRLSR ASGQEARWAL GGVPLQANEM NDITVEQGTL HLLTLHKVTL EDAGTVSFHV GTCSSEAQLK VTAGLEHHHH HH
Polymer type: polypeptide(L)
Total | 1H | 13C | |
---|---|---|---|
All | 72.8 % (737 of 1013) | 72.3 % (415 of 574) | 73.3 % (322 of 439) |
Backbone | 83.4 % (423 of 507) | 84.2 % (176 of 209) | 82.9 % (247 of 298) |
Sidechain | 65.7 % (394 of 600) | 65.5 % (239 of 365) | 66.0 % (155 of 235) |
Aromatic | 0.0 % (0 of 67) | 0.0 % (0 of 34) | 0.0 % (0 of 33) |
Methyl | 84.9 % (107 of 126) | 88.9 % (56 of 63) | 81.0 % (51 of 63) |
1. entity 1
MAPEVTILEP LQDVQLSEGQ DASFQCRLSR ASGQEARWAL GGVPLQANEM NDITVEQGTL HLLTLHKVTL EDAGTVSFHV GTCSSEAQLK VTAGLEHHHH HHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | 0.0 ~ 0.0 mM | ||
2 | TRIS | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | 0.0 ~ 0.0 mM | ||
2 | TRIS | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | 0.0 ~ 0.0 mM | ||
2 | TRIS | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | 0.0 ~ 0.0 mM | ||
6 | TRIS | natural abundance | 20 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.2, Details 20 mM TRIS, 1 mM DTT, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | 0.0 ~ 0.0 mM | ||
2 | TRIS | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_30514_6mg9.nef |
Input source #2: Coordindates | 6mg9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPEVTILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAGLEHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAPEVTILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAGLEHHHH -- HH || HH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 102 | 0 | 0 | 100.0 |
Content subtype: combined_30514_6mg9.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPEVTILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAGLEHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...EVTILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAG --------10--------20--------30--------40--------50--------60--------70--------80--------90---- -- HH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
69 | THR | HG1 | 5.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 574 | 417 | 72.6 |
13C chemical shifts | 439 | 315 | 71.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 209 | 178 | 85.2 |
13C chemical shifts | 204 | 163 | 79.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 365 | 239 | 65.5 |
13C chemical shifts | 235 | 152 | 64.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 58 | 89.2 |
13C chemical shifts | 65 | 50 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 0 | 0.0 |
13C chemical shifts | 33 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPEVTILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAGLEHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...EVTILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAG --------10--------20--------30--------40--------50--------60--------70--------80--------90---- -- HH