Solution structure of POS-1, a CCCH-type Tandem Zinc Finger protein from C. elegans
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | na | sing | 1:CYS9:SG | 2:ZN1:ZN |
2 | na | sing | 1:CYS18:SG | 2:ZN1:ZN |
3 | na | sing | 1:CYS24:SG | 2:ZN1:ZN |
4 | na | sing | 1:HIS28:NE2 | 2:ZN1:ZN |
5 | na | sing | 1:CYS52:SG | 2:ZN1:ZN |
6 | na | sing | 1:CYS61:SG | 2:ZN1:ZN |
7 | na | sing | 1:CYS67:SG | 2:ZN1:ZN |
8 | na | sing | 1:HIS71:NE2 | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.8 % (816 of 909) | 89.0 % (422 of 474) | 93.7 % (325 of 347) | 78.4 % (69 of 88) |
Backbone | 93.5 % (432 of 462) | 93.1 % (148 of 159) | 95.2 % (217 of 228) | 89.3 % (67 of 75) |
Sidechain | 87.5 % (454 of 519) | 87.0 % (274 of 315) | 93.2 % (178 of 191) | 15.4 % (2 of 13) |
Aromatic | 79.5 % (70 of 88) | 77.3 % (34 of 44) | 81.8 % (36 of 44) | |
Methyl | 100.0 % (56 of 56) | 100.0 % (28 of 28) | 100.0 % (28 of 28) |
1. entity 1
SDAFKTALCD AYKRSQACSY GDQCRFAHGV HELRLPMNPR GRNHPKYKTV LCDKFSMTGN CKYGTRCQFI HKIVDGNASolvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian Agilent VNMRS - 800 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian Agilent VNMRS - 800 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian Agilent VNMRS - 800 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Varian Agilent VNMRS - 800 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 293 K, pH 6.3, Details 0.4 mM [U-100% 13C; U-100% 15N] POS-1, 50 mM Tris-HCl pH 6.3, 100 mM potassium chloride, 100 uM Zinc Acetate, 1 mM DTT, 10 mM DSS, 92% H2O/8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POS-1 | [U-100% 13C; U-100% 15N] | 0.4 mM | |
2 | Tris-HCl pH 6.3 | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | Zinc Acetate | natural abundance | 100 uM | |
5 | DTT | natural abundance | 1 mM | |
6 | DSS | natural abundance | 10 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Non-standard residues
NoneContent subtype: bmr30571_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-------- SDAFKTALCDAYKRSQACSYGDQCRFAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNA |||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| SDAFKTALCDAYKRSQACSYGDQCRFAHGVHELRLPMNPRGR.HPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 474 | 422 | 89.0 |
13C chemical shifts | 347 | 322 | 92.8 |
15N chemical shifts | 88 | 67 | 76.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 159 | 148 | 93.1 |
13C chemical shifts | 156 | 145 | 92.9 |
15N chemical shifts | 75 | 66 | 88.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 315 | 274 | 87.0 |
13C chemical shifts | 191 | 177 | 92.7 |
15N chemical shifts | 13 | 1 | 7.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 30 | 100.0 |
13C chemical shifts | 30 | 30 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 36 | 81.8 |
13C chemical shifts | 44 | 36 | 81.8 |