Solution structure of human myeloid-derived growth factor
GSKGTVSEPT TVAFDVRPGG VVHSFSHNVG PGDKYTCMFT YASQGGTNEQ WQMSLGTSED HQHFTCTIWR PQGKSYLYFT QFKAEVRGAE IEYAMAYSKA AFERESDVPL KTEEFEVTKT AVAHRPGAFK AELSKLVIVA KASRTEL
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS37:SG | 1:CYS66:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.8 % (1622 of 1676) | 97.0 % (837 of 863) | 96.1 % (636 of 662) | 98.7 % (149 of 151) |
Backbone | 98.6 % (858 of 870) | 99.3 % (298 of 300) | 98.1 % (421 of 429) | 98.6 % (139 of 141) |
Sidechain | 95.5 % (899 of 941) | 95.7 % (539 of 563) | 95.1 % (350 of 368) | 100.0 % (10 of 10) |
Aromatic | 83.5 % (152 of 182) | 83.5 % (76 of 91) | 83.1 % (74 of 89) | 100.0 % (2 of 2) |
Methyl | 100.0 % (140 of 140) | 100.0 % (70 of 70) | 100.0 % (70 of 70) |
1. entity 1
GSKGTVSEPT TVAFDVRPGG VVHSFSHNVG PGDKYTCMFT YASQGGTNEQ WQMSLGTSED HQHFTCTIWR PQGKSYLYFT QFKAEVRGAE IEYAMAYSKA AFERESDVPL KTEEFEVTKT AVAHRPGAFK AELSKLVIVA KASRTELSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian VNS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Varian VNS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Varian VNS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Varian VNS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Varian VNS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Varian VNS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Varian VNS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MYDGF | [U-15N; U-13C] | 8.25 mg/mL | |
2 | sodium phosphate | natural abundance | 9 mM | |
3 | sodium chloride | natural abundance | 135 mM | |
4 | DSS | natural abundance | 15 uM | |
5 | sodium azide | natural abundance | 0.02 % w/v |
Properties
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:37:CYS:SG | 1:66:CYS:SG | oxidized, CA 53.64, CB 43.165 ppm | oxidized, CA 52.754, CB 42.999 ppm | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30584_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSKGTVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSKGTVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKA -------110-------120-------130-------140------- AFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL ||||||||||||||||||||||||||||||||||||||||||||||| AFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 863 | 832 | 96.4 |
13C chemical shifts | 662 | 630 | 95.2 |
15N chemical shifts | 157 | 149 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 300 | 298 | 99.3 |
13C chemical shifts | 294 | 285 | 96.9 |
15N chemical shifts | 141 | 139 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 563 | 534 | 94.8 |
13C chemical shifts | 368 | 345 | 93.8 |
15N chemical shifts | 16 | 10 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 70 | 95.9 |
13C chemical shifts | 73 | 70 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 91 | 71 | 78.0 |
13C chemical shifts | 89 | 69 | 77.5 |
15N chemical shifts | 2 | 2 | 100.0 |