Structure of WHB in complex with Ubiquitin Variant
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.0 % (2099 of 2874) | 73.1 % (1098 of 1502) | 70.2 % (778 of 1108) | 84.5 % (223 of 264) |
Backbone | 77.0 % (1096 of 1424) | 78.8 % (382 of 485) | 72.7 % (514 of 707) | 86.2 % (200 of 232) |
Sidechain | 69.5 % (1165 of 1677) | 70.4 % (716 of 1017) | 67.8 % (426 of 628) | 71.9 % (23 of 32) |
Aromatic | 67.8 % (103 of 152) | 81.6 % (62 of 76) | 52.1 % (38 of 73) | 100.0 % (3 of 3) |
Methyl | 72.2 % (221 of 306) | 73.9 % (113 of 153) | 70.6 % (108 of 153) |
1. entity 1
GMQIFVDTVQ WKTITLEVEP SDTIENVKAK IQDKEGIPPD QQRLIFAGKQ LEDGRTLSDY NIQKESALIL LLTLR2. entity 2
GMQIFVDTVQ WKTITLEVEP SDTIENVKAK IQDKEGIPPD QQRLDFAGKQ LEDGRTLSDY NIQKESALIL LLTLR3. entity 3
GSESDSGMAS QADQKEEELL LFWTYIQAML TNLESLSLDR IYNMLRMFVV TGPALAEIDL QELQGYLQKK VRDQQLVYSA GVYRLPKNCSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | indirect | na | -6.625 Hz | external | indirect | 0.25 |
1H | DSS | protons | -26.5 Hz | external | direct | 0.0 |
15N | indirect | na | 0.265 Hz | external | indirect | -0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | indirect | na | -6.625 Hz | external | indirect | 0.25 |
1H | DSS | protons | -26.5 Hz | external | direct | 0.0 |
15N | indirect | na | 0.265 Hz | external | indirect | -0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | indirect | na | -6.625 Hz | external | indirect | 0.25 |
1H | DSS | protons | -26.5 Hz | external | direct | 0.0 |
15N | indirect | na | 0.265 Hz | external | indirect | -0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | indirect | na | -6.625 Hz | external | indirect | 0.25 |
1H | DSS | protons | -26.5 Hz | external | direct | 0.0 |
15N | indirect | na | 0.265 Hz | external | indirect | -0.1 |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 800 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 800 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 800 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 600 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker AVANCE III - 700 MHz TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N] WHB, 0.6 mM Ubiquitin Variant, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | entity_2 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
3 | entity_3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | Ubiquitin Variant | natural abundance | 0.6 mM | |
5 | NaCl | natural abundance | 100 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30590_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70----- GMQIFVDTVQWKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESALILLLTLR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MQIFVDTVQWKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESALILLLTLR
--------10--------20--------30--------40--------50--------60--------70----- GMQIFVDTVQWKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLDFAGKQLEDGRTLSDYNIQKESALILLLTLR | || ||||| || | ||| | |||| ||| |||||| | |||| ||||||| | ||| ....F.DT.QWKTI..EV.....I..VKA.I..KEGI..DQQ.LDFAGK.L...RTLS...IQKESAL.L..TLR
--------10--------20--------30--------40--------50--------60--------70--------80--------90 GSESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
20 | PRO | N | 117.883 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 475 | 464 | 97.7 |
13C chemical shifts | 350 | 336 | 96.0 |
15N chemical shifts | 85 | 81 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 151 | 148 | 98.0 |
13C chemical shifts | 150 | 146 | 97.3 |
15N chemical shifts | 72 | 71 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 324 | 316 | 97.5 |
13C chemical shifts | 200 | 190 | 95.0 |
15N chemical shifts | 13 | 10 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 50 | 96.2 |
13C chemical shifts | 52 | 49 | 94.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 20 | 100.0 |
13C chemical shifts | 19 | 13 | 68.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 472 | 82 | 17.4 |
13C chemical shifts | 347 | 49 | 14.1 |
15N chemical shifts | 85 | 42 | 49.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 151 | 56 | 37.1 |
13C chemical shifts | 150 | 41 | 27.3 |
15N chemical shifts | 72 | 41 | 56.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 26 | 8.1 |
13C chemical shifts | 197 | 8 | 4.1 |
15N chemical shifts | 13 | 1 | 7.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 8 | 16.0 |
13C chemical shifts | 50 | 4 | 8.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 7 | 35.0 |
13C chemical shifts | 19 | 2 | 10.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 555 | 544 | 98.0 |
13C chemical shifts | 411 | 373 | 90.8 |
15N chemical shifts | 104 | 97 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 183 | 178 | 97.3 |
13C chemical shifts | 180 | 158 | 87.8 |
15N chemical shifts | 88 | 85 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 372 | 366 | 98.4 |
13C chemical shifts | 231 | 215 | 93.1 |
15N chemical shifts | 16 | 12 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 55 | 96.5 |
13C chemical shifts | 57 | 55 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 35 | 97.2 |
13C chemical shifts | 35 | 21 | 60.0 |
15N chemical shifts | 1 | 1 | 100.0 |