Structural Basis for Client Recognition and Activity of Hsp40 Chaperones
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.6 % (834 of 974) | 82.7 % (420 of 508) | 88.0 % (337 of 383) | 92.8 % (77 of 83) |
Backbone | 89.8 % (469 of 522) | 89.9 % (170 of 189) | 88.1 % (222 of 252) | 95.1 % (77 of 81) |
Sidechain | 82.6 % (433 of 524) | 78.4 % (250 of 319) | 90.1 % (183 of 203) | 0.0 % (0 of 2) |
Aromatic | 46.4 % (13 of 28) | 50.0 % (7 of 14) | 42.9 % (6 of 14) | |
Methyl | 95.5 % (107 of 112) | 94.6 % (53 of 56) | 96.4 % (54 of 56) |
1. entity 1
MLPLLFTPVT KGSGGSGGSG GSGRDLRAEL PLTLEEAFHG GERVVEVAGR RVSVRIPPGV REGSVIRVPG MGGQGNPPGD LLLVVRLLPHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] L11-K20_CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L11-K20_CBD1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30628_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90 MLPLLFTPVTKGSGGSGGSGGSGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRIPPGVREGSVIRVPGMGGQGNPPGDLLLVVRLLPH ||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| MLPLLFTPVTKGSGGSG.SGGSGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRIPPGVREGSVIRVPGMGGQGN.PGDLLLVVRLLPH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 508 | 417 | 82.1 |
13C chemical shifts | 383 | 337 | 88.0 |
15N chemical shifts | 92 | 77 | 83.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 189 | 171 | 90.5 |
13C chemical shifts | 180 | 153 | 85.0 |
15N chemical shifts | 81 | 77 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 319 | 246 | 77.1 |
13C chemical shifts | 203 | 184 | 90.6 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 54 | 93.1 |
13C chemical shifts | 58 | 55 | 94.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 7 | 50.0 |
13C chemical shifts | 14 | 6 | 42.9 |