NMR structure of biofilm-related EbsA from Synechococcus elongatus
MRIDELVPAD PRAVSLYTPY YSQANRRRYL PYALSLYQGS SIEGSRAVEG GAPISFVATW TVTPLPADMT RCHLQFNNDA ELTYEILLPN HEFLEYLIDM LMGYQRMQKT DFPGAFYRRL LGYDS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 65.7 % (978 of 1489) | 72.0 % (552 of 767) | 53.6 % (314 of 586) | 82.4 % (112 of 136) |
Backbone | 72.0 % (527 of 732) | 86.3 % (214 of 248) | 54.9 % (202 of 368) | 95.7 % (111 of 116) |
Sidechain | 61.0 % (534 of 875) | 63.8 % (331 of 519) | 60.4 % (203 of 336) | 0.0 % (0 of 20) |
Aromatic | 2.5 % (4 of 158) | 2.5 % (2 of 79) | 2.6 % (2 of 78) | 0.0 % (0 of 1) |
Methyl | 71.6 % (96 of 134) | 71.6 % (48 of 67) | 71.6 % (48 of 67) |
1. entity 1
MRIDELVPAD PRAVSLYTPY YSQANRRRYL PYALSLYQGS SIEGSRAVEG GAPISFVATW TVTPLPADMT RCHLQFNNDA ELTYEILLPN HEFLEYLIDM LMGYQRMQKT DFPGAFYRRL LGYDSSolvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Bruker AVANCE III - 600 MHz TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1013.25 mbar, Temperature 295 K, pH 7, Details 0.6 mM [U-99% 13C; U-99% 15N] EbsA, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EbsA | [U-99% 13C; U-99% 15N] | 0.6 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30676_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDM |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .RIDELVPADPRAVSLYTPYYSQ.NRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDM -------110-------120----- LMGYQRMQKTDFPGAFYRRLLGYDS ||||||||||||||||||||||||| LMGYQRMQKTDFPGAFYRRLLGYDS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 767 | 666 | 86.8 |
13C chemical shifts | 586 | 461 | 78.7 |
15N chemical shifts | 136 | 121 | 89.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 248 | 235 | 94.8 |
13C chemical shifts | 250 | 238 | 95.2 |
15N chemical shifts | 116 | 112 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 519 | 431 | 83.0 |
13C chemical shifts | 336 | 223 | 66.4 |
15N chemical shifts | 20 | 9 | 45.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 64 | 88.9 |
13C chemical shifts | 72 | 54 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 32 | 40.5 |
13C chemical shifts | 78 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |