Solution NMR structure of Dictyostelium discoideum Skp1A (truncated) dimer
SLVKLESSDE KVFEIEKEIA CMSVTIKNMI EDIGESDSPI PLPNVTSTIL EKVLDYCRHH HQHPGGSGLD DIPPYDRDFC KVDQPTLFEL ILAANYLDIK PLLDVTCKTV ANMIRG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 99.4 % (1335 of 1343) | 99.1 % (691 of 697) | 99.8 % (531 of 532) | 99.1 % (113 of 114) |
Backbone | 99.3 % (675 of 680) | 98.7 % (226 of 229) | 99.7 % (342 of 343) | 99.1 % (107 of 108) |
Sidechain | 99.6 % (771 of 774) | 99.4 % (465 of 468) | 100.0 % (300 of 300) | 100.0 % (6 of 6) |
Aromatic | 100.0 % (70 of 70) | 100.0 % (35 of 35) | 100.0 % (35 of 35) | |
Methyl | 100.0 % (144 of 144) | 100.0 % (72 of 72) | 100.0 % (72 of 72) |
1. entity 1
SLVKLESSDE KVFEIEKEIA CMSVTIKNMI EDIGESDSPI PLPNVTSTIL EKVLDYCRHH HQHPGGSGLD DIPPYDRDFC KVDQPTLFEL ILAANYLDIK PLLDVTCKTV ANMIRGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0, Details 0.5 mM [U-90% 13C; U-90% 15N] DDSkp1, 50 mM MES, 50 mM NaCl, 5 mM DTT, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DDSkp1 | [U-90% 13C; U-90% 15N] | 0.5 mM | |
2 | MES | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30696_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SLVKLESSDEKVFEIEKEIACMSVTIKNMIEDIGESDSPIPLPNVTSTILEKVLDYCRHHHQHPGGSGLDDIPPYDRDFCKVDQPTLFELILAANYLDIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SLVKLESSDEKVFEIEKEIACMSVTIKNMIEDIGESDSPIPLPNVTSTILEKVLDYCRHHHQHPGGSGLDDIPPYDRDFCKVDQPTLFELILAANYLDIK -------110------ PLLDVTCKTVANMIRG |||||||||||||||| PLLDVTCKTVANMIRG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
7 | SER | HG | 5.641 |
23 | SER | HG | 7.031 |
57 | CYS | HG | 2.884 |
59 | HIS | ND1 | 179.556 |
59 | HIS | NE2 | 188.261 |
60 | HIS | ND1 | 183.073 |
60 | HIS | NE2 | 179.6 |
61 | HIS | ND1 | 198.72 |
61 | HIS | NE2 | 178.696 |
63 | HIS | ND1 | 176.481 |
63 | HIS | NE2 | 186.003 |
106 | THR | HG1 | 4.075 |
107 | CYS | HG | 2.531 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 697 | 696 | 99.9 |
13C chemical shifts | 532 | 531 | 99.8 |
15N chemical shifts | 117 | 116 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 228 | 99.6 |
13C chemical shifts | 232 | 231 | 99.6 |
15N chemical shifts | 108 | 107 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 468 | 468 | 100.0 |
13C chemical shifts | 300 | 300 | 100.0 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 75 | 100.0 |
13C chemical shifts | 75 | 75 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 35 | 100.0 |
13C chemical shifts | 35 | 35 | 100.0 |