Solution structure of the TTD and linker region of UHRF1
GLYKVNEYVD ARDTNMGAWF EAQVVRVTRK APSRDEPCSS TSRPALEEDV IYHVKYDDYP ENGVVQMNSR DVRARARTII KWQDLEVGQV VMLNYNPDNP KERGFWYDAE ISRKRETRTA RELYANVVLG DDSLNDCRII FVDEVFKIER PGEGSPMVDN PMRRKSGP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.4 % (1657 of 1963) | 84.4 % (871 of 1032) | 83.9 % (634 of 756) | 86.9 % (152 of 175) |
Backbone | 88.2 % (871 of 988) | 89.3 % (299 of 335) | 87.7 % (434 of 495) | 87.3 % (138 of 158) |
Sidechain | 81.8 % (928 of 1134) | 82.1 % (572 of 697) | 81.4 % (342 of 420) | 82.4 % (14 of 17) |
Aromatic | 61.1 % (88 of 144) | 75.0 % (54 of 72) | 47.8 % (33 of 69) | 33.3 % (1 of 3) |
Methyl | 97.5 % (156 of 160) | 97.5 % (78 of 80) | 97.5 % (78 of 80) |
1. entity 1
GLYKVNEYVD ARDTNMGAWF EAQVVRVTRK APSRDEPCSS TSRPALEEDV IYHVKYDDYP ENGVVQMNSR DVRARARTII KWQDLEVGQV VMLNYNPDNP KERGFWYDAE ISRKRETRTA RELYANVVLG DDSLNDCRII FVDEVFKIER PGEGSPMVDN PMRRKSGPSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE II - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE II - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE II - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE II - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE II - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Bruker AVANCE II - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM [U-99% 13C; U-99% 15N] TTD-linker, 150 mM sodium chloride, 25 mM sodium phosphate, 5 mM DTT, 2 mM beta-mercaptoethanol, 2 mM TCEP, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TTD-linker | [U-99% 13C; U-99% 15N] | 250 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | beta-mercaptoethanol | natural abundance | 2 mM | |
6 | TCEP | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30703_6ved.nef |
Input source #2: Coordindates | 6ved.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----140-------150-------160-------170-------180-------190-------200-------210-------220-------230-- GLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----240-------250-------260-------270-------280-------290-------300 KERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP -------110-------120-------130-------140-------150-------160--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 168 | 0 | 0 | 100.0 |
Content subtype: combined_30703_6ved.nef
Assigned chemical shifts
-----140-------150-------160-------170-------180-------190-------200-------210-------220-------230-- GLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNP |||||||||||||||||||| ||||||||||| | ||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| GLYKVNEYVDARDTNMGAWF.AQVVRVTRKAP........T..PALEEDVIYHVKYDDYPENGVVQMNSRDVRARA.TIIKWQDLEVGQVVMLNYNPDNP -----240-------250-------260-------270-------280-------290-------300 KERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| KERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPM...SGP
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1032 | 857 | 83.0 |
13C chemical shifts | 756 | 616 | 81.5 |
15N chemical shifts | 193 | 149 | 77.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 335 | 296 | 88.4 |
13C chemical shifts | 336 | 283 | 84.2 |
15N chemical shifts | 158 | 135 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 697 | 561 | 80.5 |
13C chemical shifts | 420 | 333 | 79.3 |
15N chemical shifts | 35 | 14 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 85 | 85 | 100.0 |
13C chemical shifts | 85 | 85 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 50 | 69.4 |
13C chemical shifts | 69 | 29 | 42.0 |
15N chemical shifts | 3 | 1 | 33.3 |
Distance restraints
-----140-------150-------160-------170-------180-------190-------200-------210-------220-------230-- GLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNP |||||||||||||||||||| ||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GLYKVNEYVDARDTNMGAWF.AQVVRVTRKAP........T..PALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNP -----140-------150-------160-------170-------180-------190-------200-------210-------220-------230-- -----240-------250-------260-------270-------280-------290-------300 KERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP |||| |||||||||||||||||||||||||||||||||||||||||||||| |||||||||| || KERG.WYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERP.EGSPMVDNPM...SG -----240-------250-------260-------270-------280-------290---------
Dihedral angle restraints
-----140-------150-------160-------170-------180-------190-------200-------210-------220-------230-- GLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNP |||| |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| .LYKV.EYVDARDTNMGAWFEAQVVRVTRK..................DVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNP -----140-------150-------160-------170-------180-------190-------200-------210-------220-------230-- -----240-------250-------260-------270-------280-------290-------300 KERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| KERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNP...KSG -----240-------250-------260-------270-------280-------290---------