De novo designed Rossmann fold protein ROS2_36830
MGSSHHHHHH SSGLVPRGSH MGLLVLIWSN DKKLIEEARK MAEKANLYLL TLETDDKKIE DILKSLGPPV KILVLLEDTK DADKVKKEIE KKARKKNLPV RIRKVTSPDE AKRWIKEFSE E
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.5 % (1091 of 1484) | 78.1 % (611 of 782) | 65.7 % (378 of 575) | 80.3 % (102 of 127) |
Backbone | 70.9 % (508 of 716) | 82.2 % (199 of 242) | 58.7 % (210 of 358) | 85.3 % (99 of 116) |
Sidechain | 75.3 % (666 of 884) | 73.9 % (399 of 540) | 79.6 % (265 of 333) | 18.2 % (2 of 11) |
Aromatic | 27.1 % (19 of 70) | 48.6 % (17 of 35) | 0.0 % (0 of 33) | 100.0 % (2 of 2) |
Methyl | 92.1 % (129 of 140) | 92.9 % (65 of 70) | 91.4 % (64 of 70) |
1. entity 1
MGSSHHHHHH SSGLVPRGSH MGLLVLIWSN DKKLIEEARK MAEKANLYLL TLETDDKKIE DILKSLGPPV KILVLLEDTK DADKVKKEIE KKARKKNLPV RIRKVTSPDE AKRWIKEFSE ESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0, Details 0.8 mM [U-99% 13C; U-99% 15N] de novo protein RO2_20, 21.1 mM potassium phosphate monobasic, 28.9 mM sodium phosphate dibasic, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | de novo protein RO2_20 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | potassium phosphate monobasic | natural abundance | 21.1 mM | |
3 | sodium phosphate dibasic | natural abundance | 28.9 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_30708_6vgb.nef |
Input source #2: Coordindates | 6vgb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMGLLVLIWSNDKKLIEEARKMAEKANLYLLTLETDDKKIEDILKSLGPPVKILVLLEDTKDADKVKKEIEKKARKKNLPV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMGLLVLIWSNDKKLIEEARKMAEKANLYLLTLETDDKKIEDILKSLGPPVKILVLLEDTKDADKVKKEIEKKARKKNLPV -------110-------120- RIRKVTSPDEAKRWIKEFSEE ||||||||||||||||||||| RIRKVTSPDEAKRWIKEFSEE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_30708_6vgb.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMGLLVLIWSNDKKLIEEARKMAEKANLYLLTLETDDKKIEDILKSLGPPVKILVLLEDTKDADKVKKEIEKKARKKNLPV ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............LVP....MGLLVLIWSNDKKLIEEARKMAEKANLYLLTLETDDKKIEDILKSLGPPVKILVLLEDTKDADKVKKEIEKKARKKNLPV -------110-------120- RIRKVTSPDEAKRWIKEFSEE ||||||||||||||||||||| RIRKVTSPDEAKRWIKEFSEE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 782 | 612 | 78.3 |
13C chemical shifts | 575 | 370 | 64.3 |
15N chemical shifts | 127 | 101 | 79.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 242 | 204 | 84.3 |
13C chemical shifts | 242 | 103 | 42.6 |
15N chemical shifts | 116 | 99 | 85.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 540 | 408 | 75.6 |
13C chemical shifts | 333 | 267 | 80.2 |
15N chemical shifts | 11 | 2 | 18.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 67 | 91.8 |
13C chemical shifts | 73 | 65 | 89.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 17 | 48.6 |
13C chemical shifts | 33 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMGLLVLIWSNDKKLIEEARKMAEKANLYLLTLETDDKKIEDILKSLGPPVKILVLLEDTKDADKVKKEIEKKARKKNLPV || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............LV.....MGLLVLIWSNDKKLIEEARKMAEKANLYLLTLETDDKKIEDILKSLGPPVKILVLLEDTKDADKVKKEIEKKARKKNLPV -------110-------120- RIRKVTSPDEAKRWIKEFSEE ||||||||||||||||||||| RIRKVTSPDEAKRWIKEFSEE
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMGLLVLIWSNDKKLIEEARKMAEKANLYLLTLETDDKKIEDILKSLGPPVKILVLLEDTKDADKVKKEIEKKARKKNLPV ||||| ||||||||||||| | | ||||||||||| ||||||| ||||||||||||||| .......................LVLIW...KKLIEEARKMAEK...Y.L....DDKKIEDILKS.....KILVLLE...DADKVKKEIEKKARK..... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120- RIRKVTSPDEAKRWIKEFSEE | | |||||||||||| R.R....PDEAKRWIKEFS -------110---------