Solution NMR structure of human Brd3 ET domain with MLV IN C-terminal Tail Peptide (TP) complex
HHHHHHSHMG KQASASYDSE EEEEGLPMSY DEKRQLSLDI NRLPGEKLGR VVHIIQSREP SLRDSNPDEI EIDFETLKPT TLRELERYVK SCLQKK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.4 % (1132 of 1443) | 84.6 % (645 of 762) | 68.4 % (374 of 547) | 84.3 % (113 of 134) |
Backbone | 76.7 % (537 of 700) | 91.1 % (214 of 235) | 62.6 % (221 of 353) | 91.1 % (102 of 112) |
Sidechain | 81.5 % (699 of 858) | 81.8 % (431 of 527) | 83.2 % (257 of 309) | 50.0 % (11 of 22) |
Aromatic | 66.7 % (52 of 78) | 66.7 % (26 of 39) | 65.8 % (25 of 38) | 100.0 % (1 of 1) |
Methyl | 96.3 % (104 of 108) | 94.4 % (51 of 54) | 98.1 % (53 of 54) |
1. entity 1
HHHHHHSHMG KQASASYDSE EEEEGLPMSY DEKRQLSLDI NRLPGEKLGR VVHIIQSREP SLRDSNPDEI EIDFETLKPT TLRELERYVK SCLQKK2. entity 2
SRLTWRVQRS QNPLKIRLTR EAPSolvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium chloride | natural abundance | 100 (±0.02) mM | |
10 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
11 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
12 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] MLV IN TP, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN TP | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 (±0.02) mM | |
3 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
4 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 100 (±0.02) mM | |
6 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
7 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
8 | Brd3 ET | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium chloride | natural abundance | 100 (±0.02) mM | |
10 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
11 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
12 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium chloride | natural abundance | 100 (±0.02) mM | |
10 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
11 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
12 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Bruker AVANCE - 800 MHz Equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM Brd3 ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 100 (±0.02) mM | |
14 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
15 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
16 | Brd3 ET | natural abundance | 0.5 (±0.02) mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30786_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ HHHHHHSHMGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........MGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKK
--------10--------20--- SRLTWRVQRSQNPLKIRLTREAP |||||||||||||||||||||| SRLTWRVQRSQNPLKIRLTREA --------10--------20--
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 603 | 497 | 82.4 |
13C chemical shifts | 437 | 281 | 64.3 |
15N chemical shifts | 104 | 88 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 191 | 174 | 91.1 |
13C chemical shifts | 192 | 87 | 45.3 |
15N chemical shifts | 91 | 82 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 412 | 323 | 78.4 |
13C chemical shifts | 245 | 194 | 79.2 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 41 | 95.3 |
13C chemical shifts | 43 | 41 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 18 | 54.5 |
13C chemical shifts | 33 | 18 | 54.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 159 | 146 | 91.8 |
13C chemical shifts | 110 | 77 | 70.0 |
15N chemical shifts | 30 | 21 | 70.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 42 | 95.5 |
13C chemical shifts | 46 | 20 | 43.5 |
15N chemical shifts | 21 | 17 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 115 | 104 | 90.4 |
13C chemical shifts | 64 | 57 | 89.1 |
15N chemical shifts | 9 | 4 | 44.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 13 | 100.0 |
13C chemical shifts | 13 | 13 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 6 | 6 | 100.0 |
13C chemical shifts | 5 | 5 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |