Solution NMR structure of human Brd3 ET complexed with NSD3(148-184) peptide
HHHHHHSHMG KQASASYDSE EEEEGLPMSY DEKRQLSLDI NRLPGEKLGR VVHIIQSREP SLRDSNPDEI EIDFETLKPT TLRELERYVK SCLQKK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.9 % (1245 of 1598) | 83.7 % (703 of 840) | 67.9 % (415 of 611) | 86.4 % (127 of 147) |
Backbone | 76.7 % (612 of 798) | 90.4 % (245 of 271) | 63.1 % (251 of 398) | 89.9 % (116 of 129) |
Sidechain | 81.0 % (752 of 928) | 80.5 % (458 of 569) | 83.0 % (283 of 341) | 61.1 % (11 of 18) |
Aromatic | 51.2 % (44 of 86) | 51.2 % (22 of 43) | 51.2 % (22 of 43) | |
Methyl | 99.2 % (125 of 126) | 98.4 % (62 of 63) | 100.0 % (63 of 63) |
1. entity 1
HHHHHHSHMG KQASASYDSE EEEEGLPMSY DEKRQLSLDI NRLPGEKLGR VVHIIQSREP SLRDSNPDEI EIDFETLKPT TLRELERYVK SCLQKK2. entity 2
EFTGSPEIKL KITKTIQNGR ELFESSLCGD LLNEVQASESolvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.5 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.5 (±0.02) mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | 2-mercaptoethanol | natural abundance | 2 mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE - 800 MHz equipped with 5mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM NSD3(148-184), 0.25 mM U-100% 13C; U-100% 15 Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | NSD3(148-184) | natural abundance | 0.25 (±0.02) mM | |
6 | sodium chloride | natural abundance | 100 (±0.02) mM | |
7 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
8 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
9 | Brd3ET | U-100% 13C; U-100% 15 | 0.25 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Bruker AVANCE III HD - 600 MHz Equipped with 5mm TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 7.0 (±0.05), Details 0.25 mM [U-100% 13C; U-100% 15N] NSD3(148-184), 0.2 mM [U-100% 13C; U-100% 15N] Brd3ET, 100 mM sodium chloride, 20 mM sodium phosphate, 2 mM 2-mercaptoethanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NSD3(148-184) | [U-100% 13C; U-100% 15N] | 0.25 (±0.02) mM | |
11 | sodium chloride | natural abundance | 100 (±0.02) mM | |
12 | sodium phosphate | natural abundance | 20 (±0.02) mM | |
13 | 2-mercaptoethanol | natural abundance | 2 (±0.02) mM | |
14 | Brd3ET | [U-100% 13C; U-100% 15N] | 0.2 (±0.02) mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30790_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ HHHHHHSHMGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........MGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKK
--------10--------20--------30--------- EFTGSPEIKLKITKTIQNGRELFESSLCGDLLNEVQASE ||||||||||||||||||||||||||||||||||||||| EFTGSPEIKLKITKTIQNGRELFESSLCGDLLNEVQASE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 603 | 515 | 85.4 |
13C chemical shifts | 437 | 289 | 66.1 |
15N chemical shifts | 104 | 88 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 191 | 174 | 91.1 |
13C chemical shifts | 192 | 88 | 45.8 |
15N chemical shifts | 91 | 82 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 412 | 341 | 82.8 |
13C chemical shifts | 245 | 201 | 82.0 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 43 | 100.0 |
13C chemical shifts | 43 | 43 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 17 | 51.5 |
13C chemical shifts | 33 | 17 | 51.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 237 | 194 | 81.9 |
13C chemical shifts | 174 | 119 | 68.4 |
15N chemical shifts | 43 | 35 | 81.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 72 | 90.0 |
13C chemical shifts | 78 | 39 | 50.0 |
15N chemical shifts | 38 | 32 | 84.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 157 | 122 | 77.7 |
13C chemical shifts | 96 | 80 | 83.3 |
15N chemical shifts | 5 | 3 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 21 | 95.5 |
13C chemical shifts | 22 | 20 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 5 | 50.0 |
13C chemical shifts | 10 | 5 | 50.0 |