BMRBj - BMREntryMaster

ID	Entity ID	Seq ID	Comp ID	Atom ID	Atom type	Val	Val err	Ambig. code
1	1	3	THR	C	C	177.19	0.030	1
2	1	3	THR	CA	C	61.38	0.050	1
3	1	4	VAL	H	H	8.11	0.002	1
4	1	4	VAL	C	C	177.70	0.030	1
5	1	4	VAL	CA	C	61.66	0.050	1
6	1	4	VAL	N	N	119.58	0.020	1
7	1	5	LEU	H	H	7.90	0.002	1
8	1	5	LEU	C	C	179.85	0.030	1
9	1	5	LEU	CA	C	56.18	0.050	1
10	1	5	LEU	N	N	120.40	0.020	1
11	1	6	LEU	H	H	8.27	0.002	1
12	1	6	LEU	CA	C	58.45	0.050	1
13	1	6	LEU	N	N	118.39	0.020	1
14	1	7	PRO	C	C	179.60	0.030	1
15	1	7	PRO	CA	C	65.08	0.050	1
16	1	8	LEU	H	H	7.36	0.002	1
17	1	8	LEU	C	C	180.34	0.030	1
18	1	8	LEU	CA	C	57.21	0.050	1
19	1	8	LEU	N	N	115.82	0.020	1
20	1	9	VAL	H	H	8.28	0.002	1
21	1	9	VAL	C	C	179.89	0.030	1
22	1	9	VAL	CA	C	65.70	0.050	1
23	1	9	VAL	N	N	119.30	0.020	1
24	1	10	ILE	H	H	8.09	0.002	1
25	1	10	ILE	C	C	179.31	0.030	1
26	1	10	ILE	CA	C	64.16	0.050	1
27	1	10	ILE	N	N	119.49	0.020	1
28	1	11	PHE	H	H	8.47	0.002	1
29	1	11	PHE	C	C	178.78	0.030	1
30	1	11	PHE	CA	C	60.75	0.050	1
31	1	11	PHE	N	N	119.39	0.020	1
32	1	12	PHE	H	H	8.68	0.002	1
33	1	12	PHE	C	C	179.72	0.030	1
34	1	12	PHE	CA	C	60.32	0.050	1
35	1	12	PHE	N	N	118.02	0.020	1
36	1	13	GLY	H	H	8.70	0.002	1
37	1	13	GLY	C	C	176.68	0.030	1
38	1	13	GLY	CA	C	46.35	0.050	1
39	1	13	GLY	N	N	107.47	0.020	1
40	1	14	LEU	H	H	8.45	0.002	1
41	1	14	LEU	C	C	181.68	0.030	1
42	1	14	LEU	CA	C	56.49	0.050	1
43	1	14	LEU	N	N	121.23	0.020	1
44	1	15	ALA	H	H	8.41	0.002	1
45	1	15	ALA	C	C	180.83	0.030	1
46	1	15	ALA	CA	C	54.19	0.050	1
47	1	15	ALA	N	N	124.44	0.020	1
48	1	16	LEU	H	H	8.16	0.002	1
49	1	16	LEU	C	C	180.44	0.030	1
50	1	16	LEU	CA	C	56.88	0.050	1
51	1	16	LEU	N	N	118.20	0.020	1
52	1	17	LEU	H	H	8.14	0.002	1
53	1	17	LEU	C	C	180.37	0.030	1
54	1	17	LEU	CA	C	56.81	0.050	1
55	1	17	LEU	N	N	118.20	0.020	1
56	1	18	SER	H	H	8.04	0.002	1
57	1	18	SER	C	C	177.49	0.030	1
58	1	18	SER	CA	C	62.47	0.050	1
59	1	18	SER	N	N	115.36	0.020	1
60	1	19	LEU	H	H	7.80	0.002	1
61	1	19	LEU	C	C	180.37	0.030	1
62	1	19	LEU	CA	C	56.73	0.050	1
63	1	19	LEU	N	N	121.87	0.020	1
64	1	20	LEU	H	H	8.00	0.002	1
65	1	20	LEU	C	C	180.05	0.030	1
66	1	20	LEU	CA	C	56.95	0.050	1
67	1	20	LEU	N	N	119.21	0.020	1
68	1	21	PHE	H	H	8.25	0.002	1
69	1	21	PHE	C	C	179.32	0.030	1
70	1	21	PHE	CA	C	60.42	0.050	1
71	1	21	PHE	N	N	117.84	0.020	1
72	1	22	ILE	H	H	8.36	0.002	1
73	1	22	ILE	C	C	179.70	0.030	1
74	1	22	ILE	CA	C	64.04	0.050	1
75	1	22	ILE	N	N	119.30	0.020	1
76	1	23	GLY	H	H	8.49	0.002	1
77	1	23	GLY	C	C	177.35	0.030	1
78	1	23	GLY	CA	C	46.45	0.050	1
79	1	23	GLY	N	N	107.20	0.020	1
80	1	24	LEU	H	H	8.34	0.002	1
81	1	24	LEU	C	C	180.45	0.030	1
82	1	24	LEU	CA	C	56.51	0.050	1
83	1	24	LEU	N	N	121.41	0.020	1
84	1	25	ALA	H	H	8.26	0.002	1
85	1	25	ALA	C	C	181.22	0.030	1
86	1	25	ALA	CA	C	53.86	0.050	1
87	1	25	ALA	N	N	121.60	0.020	1
88	1	26	TYR	H	H	8.18	0.002	1
89	1	26	TYR	C	C	179.41	0.030	1
90	1	26	TYR	CA	C	59.69	0.050	1
91	1	26	TYR	N	N	117.10	0.020	1
92	1	27	ARG	H	H	7.80	0.002	1
93	1	27	ARG	C	C	179.15	0.030	1
94	1	27	ARG	CA	C	56.07	0.050	1
95	1	27	ARG	N	N	118.11	0.020	1
96	1	28	TYR	H	H	7.83	0.002	1
97	1	28	TYR	C	C	177.39	0.030	1
98	1	28	TYR	CA	C	58.11	0.050	1
99	1	28	TYR	N	N	118.11	0.020	1
100	1	29	GLN	H	H	7.53	0.002	1
101	1	29	GLN	C	C	176.65	0.030	1
102	1	29	GLN	CA	C	54.73	0.050	1
103	1	29	GLN	N	N	120.31	0.020	1
104	1	30	ARG	H	H	7.64	0.002	1
105	1	30	ARG	CA	C	56.28	0.050	1
106	1	30	ARG	N	N	127.56	0.020	1

Protein Blocks Logo

Calculated from 15 models in PDB: 7K7A, Strand ID: A, B, C Detail

Release date

2020-09-23

Citation

The Diversity and Similarity of Transmembrane Trimerization of TNF Receptors
Zhao, L., Fu, Q., Pan, L., Piai, A., Chou, J.
Front. Cell Dev. Biol. (2020), 8, 569684-569684, PubMed 33163490 , DOI 10.3389/fcell.2020.569684 , Abstract

Related entities 1. Tumor necrosis factor receptor superfamily member 1A, : 1 : 2 : 6 entities Detail

Interaction partners 1. Tumor necrosis factor receptor superfamily member 1A, : 99 interactors Detail

More details for 99 interactors identified by 16 citations

Experiments performed 7 experiments Detail

1 3D HNCO

Instrument

Bruker AVANCE - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8, Details 0.7 mM [U-100% 13C; U-100% 15N; U-80% 2H] Protein, 20 mM sodium phosphate, 50 mM DMPC, 100 mM DHPC, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	Protein	[U-100% 13C; U-100% 15N; U-80% 2H]	0.7 mM
2	sodium phosphate	natural abundance	20 mM
3	DMPC	natural abundance	50 mM
4	DHPC	natural abundance	100 mM

2 3D HNCA

Instrument

Bruker AVANCE - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	Protein	[U-100% 13C; U-100% 15N; U-80% 2H]	0.7 mM
2	sodium phosphate	natural abundance	20 mM
3	DMPC	natural abundance	50 mM
4	DHPC	natural abundance	100 mM

3 3D HNCACO

Instrument

Bruker AVANCE - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	Protein	[U-100% 13C; U-100% 15N; U-80% 2H]	0.7 mM
2	sodium phosphate	natural abundance	20 mM
3	DMPC	natural abundance	50 mM
4	DHPC	natural abundance	100 mM

4 3D 1H-15N NOESY

Instrument

Bruker AVANCE - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8, Details 0.7 mM [U-100% 13C; U-100% 15N] Protein, 20 mM sodium phosphate, 50 mM DMPC, 100 mM DHPC, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
5	Protein	[U-100% 13C; U-100% 15N]	0.7 mM
6	sodium phosphate	natural abundance	20 mM
7	DMPC	natural abundance	50 mM
8	DHPC	natural abundance	100 mM

5 3D 1H-15N NOESY

Instrument

Bruker AVANCE - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8, Details 0.4 mM [U-100% 13C] Protein A, 20 mM sodium phosphate, 50 mM DMPC, 100 mM DHPC, 0.4 mM [U-100% 2H; U-100% 15N] Protein B, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
9	sodium phosphate	natural abundance	20 mM
10	DMPC	natural abundance	50 mM
11	DHPC	natural abundance	100 mM
12	Protein A	[U-100% 13C]	0.4 mM
13	Protein B	[U-100% 2H; U-100% 15N]	0.4 mM

6 3D 1H-13C NOESY FOR METHYLS

Instrument

Bruker AVANCE - 750 MHz

Sample

#	Name	Isotope labeling	Concentration
9	sodium phosphate	natural abundance	20 mM
10	DMPC	natural abundance	50 mM
11	DHPC	natural abundance	100 mM
12	Protein A	[U-100% 13C]	0.4 mM
13	Protein B	[U-100% 2H; U-100% 15N]	0.4 mM

7 2D 1H-13C HSQC

Instrument

Bruker AVANCE - 750 MHz

Sample

#	Name	Isotope labeling	Concentration
5	Protein	[U-100% 13C; U-100% 15N]	0.7 mM
6	sodium phosphate	natural abundance	20 mM
7	DMPC	natural abundance	50 mM
8	DHPC	natural abundance	100 mM

NMR combined restraints 3 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints	combined_30799_7k7a.nef
Input source #2: Coordindates	7k7a.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

-210-----220-------230--------
GTTVLLPLVIFFGLALLSLLFIGLAYRYQR
||||||||||||||||||||||||||||||
GTTVLLPLVIFFGLALLSLLFIGLAYRYQR
--------10--------20--------30

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

-210-----220-------230--------
GTTVLLPLVIFFGLALLSLLFIGLAYRYQR
||||||||||||||||||||||||||||||
GTTVLLPLVIFFGLALLSLLFIGLAYRYQR
--------10--------20--------30

Entity_assembly_ID (NMR): C vs Auth_asym_ID (model): C

-210-----220-------230--------
GTTVLLPLVIFFGLALLSLLFIGLAYRYQR
||||||||||||||||||||||||||||||
GTTVLLPLVIFFGLALLSLLFIGLAYRYQR
--------10--------20--------30

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Sequence coverage (%)
A	A	30	100.0
B	B	30	100.0
C	C	30	100.0

Content subtype: combined_30799_7k7a.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chemical_shifts_1	OK	106		93.3 (chain: A, length: 30)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	612 (1)	noe	93.3 (chain: A, length: 30), 93.3 (chain: B, length: 30), 93.3 (chain: C, length: 30)

Assigned chemical shifts

Saveframe: assigned_chemical_shifts_1
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 30, Sequence coverage: 93.3%
- Total number of assignments
  - ¹³C chemical shifts: 54
  - ¹H chemical shifts: 26
  - ¹⁵N chemical shifts: 26
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	156	54	34.6
¹H chemical shifts	190	26	13.7
¹⁵N chemical shifts	32	26	81.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	60	54	90.0
¹H chemical shifts	62	26	41.9
¹⁵N chemical shifts	29	26	89.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	96	0	0.0
¹H chemical shifts	128	0	0.0
¹⁵N chemical shifts	3	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	30	0	0.0
¹H chemical shifts	30	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	23	0	0.0
¹H chemical shifts	23	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 30, Sequence coverage: 93.3%
  - Entity_assembly_ID: B, Chain length: 30, Sequence coverage: 93.3%
  - Entity_assembly_ID: C, Chain length: 30, Sequence coverage: 93.3%
- Total number of restraints: 612
- Weight of restraints: 1.0 (612)
- Potential type of restraints: square-well-parabolic (612)
- Range of distance target values: 2.0, 4.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
  - Chain_ID: C
- Distance restraints on contact map

Keywords APOPTOSIS, TRANSMEMBRANE HELIX

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.042 seconds)

BMRB: 30799

Related entities 1. Tumor necrosis factor receptor superfamily member 1A, : 1 : 2 : 6 entities Detail

Interaction partners 1. Tumor necrosis factor receptor superfamily member 1A, : 99 interactors Detail

Experiments performed 7 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 3 contents Detail