Solution Structure of the Corynebacterium diphtheriae SpaA Pilin-Signal Peptide Complex
ERTSIAVHAL MGLPTGQPAN GTKLDSIGLP KVDGMSFTLY RVNEIDLTTQ AGWDAASKIK LEELYTNGHP TDKVTKVATK KTEGGVAKFD NLTPALYLVV QELNGAEAVV RSQPFLVAAP QTNPTGDGWL QDVHVYPKHQ ALS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.7 % (1504 of 1735) | 85.7 % (764 of 891) | 88.0 % (600 of 682) | 86.4 % (140 of 162) |
Backbone | 92.5 % (831 of 898) | 94.8 % (293 of 309) | 91.7 % (409 of 446) | 90.2 % (129 of 143) |
Sidechain | 81.6 % (797 of 977) | 80.4 % (468 of 582) | 84.6 % (318 of 376) | 57.9 % (11 of 19) |
Aromatic | 57.1 % (64 of 112) | 60.7 % (34 of 56) | 51.9 % (28 of 54) | 100.0 % (2 of 2) |
Methyl | 90.8 % (178 of 196) | 92.9 % (91 of 98) | 88.8 % (87 of 98) |
1. entity 1
ERTSIAVHAL MGLPTGQPAN GTKLDSIGLP KVDGMSFTLY RVNEIDLTTQ AGWDAASKIK LEELYTNGHP TDKVTKVATK KTEGGVAKFD NLTPALYLVV QELNGAEAVV RSQPFLVAAP QTNPTGDGWL QDVHVYPKHQ ALS2. entity 2
KNAGFELPLTSolvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
7 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
8 | NaH2PO4 | natural abundance | 50 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | NaN3 | natural abundance | 0.01 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 92% H2O, 8% D2O, Pressure 1 null, Temperature 298 K, pH 6.0, Details 1.2 mM [U-13C; U-15N] SpaA backbone pilin for protein, 1.2 mM SpaA sorting signal for peptide, 50 mM NaH2PO4, 100 mM NaCl, 0.01 % NaN3, 92% H2O, 8% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SpaA backbone pilin for protein | [U-13C; U-15N] | 1.2 mM | |
2 | SpaA sorting signal for peptide | natural abundance | 1.2 mM | |
3 | NaH2PO4 | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | NaN3 | natural abundance | 0.01 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30800_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ERTSIAVHALMGLPTGQPANGTKLDSIGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .RTSIAVHALMGLPTGQPANGTKLDSIGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVV -------110-------120-------130-------140--- QELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALS ||||||||||||||||||||||||||||||||||||||||||| QELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALS
--------10 KNAGFELPLT |||||||||| KNAGFELPLT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 829 | 715 | 86.2 |
13C chemical shifts | 635 | 600 | 94.5 |
15N chemical shifts | 152 | 137 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 289 | 276 | 95.5 |
13C chemical shifts | 286 | 281 | 98.3 |
15N chemical shifts | 134 | 126 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 540 | 439 | 81.3 |
13C chemical shifts | 349 | 319 | 91.4 |
15N chemical shifts | 18 | 11 | 61.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 94 | 89 | 94.7 |
13C chemical shifts | 94 | 90 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 31 | 60.8 |
13C chemical shifts | 49 | 28 | 57.1 |
15N chemical shifts | 2 | 2 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 49 | 79.0 |
13C chemical shifts | 47 | 0 | 0.0 |
15N chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 18 | 90.0 |
13C chemical shifts | 20 | 0 | 0.0 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 31 | 73.8 |
13C chemical shifts | 27 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 6 | 6 | 100.0 |
13C chemical shifts | 6 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 5 | 3 | 60.0 |
13C chemical shifts | 5 | 0 | 0.0 |