Structure and Interactions of DED1 of human cFLIP
MHHHHHHMSA EVIHQVEEAL SSSELTELKY LCLGRVGKRK LERVQSGVRD LLDILRERGK LSVGDLAELL YRVRRFDLLK RILKMDRKAV ETHLLRNPHL VSDYR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.9 % (1040 of 1285) | 86.4 % (577 of 668) | 72.8 % (362 of 497) | 84.2 % (101 of 120) |
Backbone | 81.4 % (511 of 628) | 92.5 % (198 of 214) | 69.7 % (216 of 310) | 93.3 % (97 of 104) |
Sidechain | 81.9 % (620 of 757) | 83.5 % (379 of 454) | 82.6 % (237 of 287) | 25.0 % (4 of 16) |
Aromatic | 58.6 % (41 of 70) | 60.0 % (21 of 35) | 57.1 % (20 of 35) | |
Methyl | 89.0 % (121 of 136) | 91.2 % (62 of 68) | 86.8 % (59 of 68) |
1. entity 1
MHHHHHHMSA EVIHQVEEAL SSSELTELKY LCLGRVGKRK LERVQSGVRD LLDILRERGK LSVGDLAELL YRVRRFDLLK RILKMDRKAV ETHLLRNPHL VSDYRSolvent system 99% H2O/1% D2O, Pressure 1 atm, Temperature 291 K, pH 5.8, Details 20 mM sodium succinate, 250 mM sodium chloride, 3 mM DTT, 0.2 mM pefabloc, 99% H2O/1% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 300 uM | |
2 | sodium succinate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | pefabloc | natural abundance | 0.2 mM |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.0 % (2081 of 2570) | 86.4 % (1154 of 1336) | 72.7 % (723 of 994) | 85.0 % (204 of 240) |
Backbone | 81.1 % (1018 of 1256) | 92.5 % (396 of 428) | 68.7 % (426 of 620) | 94.2 % (196 of 208) |
Sidechain | 82.4 % (1248 of 1514) | 83.5 % (758 of 908) | 84.0 % (482 of 574) | 25.0 % (8 of 32) |
Aromatic | 58.6 % (82 of 140) | 60.0 % (42 of 70) | 57.1 % (40 of 70) | |
Methyl | 90.1 % (245 of 272) | 91.9 % (125 of 136) | 88.2 % (120 of 136) |
1. entity 1
MHHHHHHMSA EVIHQVEEAL SSSELTELKY LCLGRVGKRK LERVQSGVRD LLDILRERGK LSVGDLAELL YRVRRFDLLK RILKMDRKAV ETHLLRNPHL VSDYRSolvent system 99% H2O/1% D2O, Pressure 1 atm, Temperature 291 K, pH 5.8, Details 20 mM sodium succinate, 250 mM sodium chloride, 3 mM DTT, 0.2 mM pefabloc, 99% H2O/1% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 300 uM | |
2 | sodium succinate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | pefabloc | natural abundance | 0.2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 99% H2O/1% D2O, Pressure 1 atm, Temperature 291 K, pH 5.8, Details 20 mM sodium succinate, 250 mM sodium chloride, 3 mM DTT, 0.2 mM pefabloc, 99% H2O/1% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 300 uM | |
2 | sodium succinate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | pefabloc | natural abundance | 0.2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 99% H2O/1% D2O, Pressure 1 atm, Temperature 291 K, pH 5.8, Details 20 mM sodium succinate, 250 mM sodium chloride, 3 mM DTT, 0.2 mM pefabloc, 99% H2O/1% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 300 uM | |
2 | sodium succinate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | pefabloc | natural abundance | 0.2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 99% H2O/1% D2O, Pressure 1 atm, Temperature 291 K, pH 5.8, Details 20 mM sodium succinate, 250 mM sodium chloride, 3 mM DTT, 0.2 mM pefabloc, 99% H2O/1% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 300 uM | |
2 | sodium succinate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | pefabloc | natural abundance | 0.2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 99% H2O/1% D2O, Pressure 1 atm, Temperature 291 K, pH 5.8, Details 20 mM sodium succinate, 250 mM sodium chloride, 3 mM DTT, 0.2 mM pefabloc, 99% H2O/1% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 300 uM | |
2 | sodium succinate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | pefabloc | natural abundance | 0.2 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30874_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHMSAEVIHQVEEALSSSELTELKYLCLGRVGKRKLERVQSGVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHL ||||||||||||||||||||||||||||||||||||||||||| ||||||||| ||||||||||||||||||||||||||||||||||||||| ......HMSAEVIHQVEEALSSSELTELKYLCLGRVGKRKLERVQSGVR.LLDILRERG..SVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHL ----- VSDYR ||||| VSDYR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 668 | 568 | 85.0 |
13C chemical shifts | 497 | 331 | 66.6 |
15N chemical shifts | 120 | 95 | 79.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 190 | 88.8 |
13C chemical shifts | 210 | 95 | 45.2 |
15N chemical shifts | 104 | 91 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 454 | 378 | 83.3 |
13C chemical shifts | 287 | 236 | 82.2 |
15N chemical shifts | 16 | 4 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 63 | 88.7 |
13C chemical shifts | 71 | 60 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 21 | 60.0 |
13C chemical shifts | 35 | 20 | 57.1 |
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHMSAEVIHQVEEALSSSELTELKYLCLGRVGKRKLERVQSGVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHL ||||||||||||||||||||||||||||||||||||||||||| ||||||||| ||||||||||||||||||||||||||||||||||||||| ......HMSAEVIHQVEEALSSSELTELKYLCLGRVGKRKLERVQSGVR.LLDILRERG..SVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHL ----- VSDYR ||||| VSDYR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 668 | 568 | 85.0 |
13C chemical shifts | 497 | 331 | 66.6 |
15N chemical shifts | 120 | 94 | 78.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 190 | 88.8 |
13C chemical shifts | 210 | 95 | 45.2 |
15N chemical shifts | 104 | 91 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 454 | 378 | 83.3 |
13C chemical shifts | 287 | 236 | 82.2 |
15N chemical shifts | 16 | 3 | 18.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 63 | 88.7 |
13C chemical shifts | 71 | 60 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 21 | 60.0 |
13C chemical shifts | 35 | 20 | 57.1 |