Solution NMR structure of de novo designed protein 0515
MDFTERLDRL VKYAKEIAKW YKESGDPDFA NSVDNVLGHL ENIRKAFKHG DPARAMDHVS NVVGSLDSIQ TSFKQTGNPE IATRWQELTQ EVRELYAYLG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.8 % (1097 of 1182) | 93.8 % (574 of 612) | 92.3 % (421 of 456) | 89.5 % (102 of 114) |
Backbone | 95.1 % (565 of 594) | 95.1 % (193 of 203) | 95.2 % (280 of 294) | 94.8 % (92 of 97) |
Sidechain | 91.6 % (625 of 682) | 93.2 % (381 of 409) | 91.4 % (234 of 256) | 58.8 % (10 of 17) |
Aromatic | 82.4 % (89 of 108) | 96.3 % (52 of 54) | 67.3 % (35 of 52) | 100.0 % (2 of 2) |
Methyl | 99.0 % (101 of 102) | 100.0 % (51 of 51) | 98.0 % (50 of 51) |
1. entity 1
MDFTERLDRL VKYAKEIAKW YKESGDPDFA NSVDNVLGHL ENIRKAFKHG DPARAMDHVS NVVGSLDSIQ TSFKQTGNPE IATRWQELTQ EVRELYAYLGSolvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.3 mM [U-5% 13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | protein | [U-5% 13C; U-15N] | 0.3 (±0.05) mM | |
6 | HEPES | natural abundance | 25 (±2.0) mM | |
7 | sodium chloride | natural abundance | 50 (±5.0) mM | |
8 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.9 mM [U-13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 0.9 (±0.1) mM | |
2 | HEPES | natural abundance | 25 (±2.0) mM | |
3 | sodium chloride | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.02 (±0.005) % |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±.1) atm, Temperature 298 (±1) K, pH 7.2, Details 0.3 mM [U-5% 13C; U-15N] protein, 25 mM HEPES, 50 mM sodium chloride, 0.02 % sodium azide, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | protein | [U-5% 13C; U-15N] | 0.3 (±0.05) mM | |
6 | HEPES | natural abundance | 25 (±2.0) mM | |
7 | sodium chloride | natural abundance | 50 (±5.0) mM | |
8 | sodium azide | natural abundance | 0.02 (±0.005) % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30890_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDFTERLDRLVKYAKEIAKWYKESGDPDFANSVDNVLGHLENIRKAFKHGDPARAMDHVSNVVGSLDSIQTSFKQTGNPEIATRWQELTQEVRELYAYLG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||| MDFTERLDRLVKYAKEIAKWYKESGDPDFANSVDNVLGHLENIRKAFKHGDPARAMDHVSNVVGSLDSIQTSFK.T.NPEIATRWQELTQEVRELYAYLG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 612 | 573 | 93.6 |
13C chemical shifts | 456 | 419 | 91.9 |
15N chemical shifts | 114 | 102 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 203 | 195 | 96.1 |
13C chemical shifts | 200 | 188 | 94.0 |
15N chemical shifts | 97 | 92 | 94.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 409 | 378 | 92.4 |
13C chemical shifts | 256 | 231 | 90.2 |
15N chemical shifts | 17 | 10 | 58.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 52 | 98.1 |
13C chemical shifts | 53 | 51 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 52 | 96.3 |
13C chemical shifts | 52 | 33 | 63.5 |
15N chemical shifts | 2 | 2 | 100.0 |