Solution NMR structure of substrate bound peptidase domain from PCAT1
SNAMLRRLFK KKYVCVRQYD LTDAGAACLS SIAQYYGLKM SLAKIREMTG TDTQGTNAYG LIHAAKQLGF SAKGVKASKE DLLKDFRLPA IANVIVDNRL AHFVVIYSIK NRIITVADPG KGIVRYSMDD FCSIWTGGLV LLEPGEAFQK G
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.8 % (1623 of 2033) | 79.3 % (829 of 1046) | 80.5 % (638 of 793) | 80.4 % (156 of 194) |
Backbone | 83.2 % (869 of 1044) | 82.1 % (298 of 363) | 83.9 % (427 of 509) | 83.7 % (144 of 172) |
Sidechain | 77.0 % (884 of 1148) | 77.7 % (531 of 683) | 77.0 % (341 of 443) | 54.5 % (12 of 22) |
Aromatic | 71.9 % (105 of 146) | 86.3 % (63 of 73) | 56.9 % (41 of 72) | 100.0 % (1 of 1) |
Methyl | 87.0 % (188 of 216) | 87.0 % (94 of 108) | 87.0 % (94 of 108) |
1. entity 1
SNAMLRRLFK KKYVCVRQYD LTDAGAACLS SIAQYYGLKM SLAKIREMTG TDTQGTNAYG LIHAAKQLGF SAKGVKASKE DLLKDFRLPA IANVIVDNRL AHFVVIYSIK NRIITVADPG KGIVRYSMDD FCSIWTGGLV LLEPGEAFQK G2. entity 2
LNIGRELTDE ELMEMTGGST FSIQSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 700 MHz QCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 700 MHz QCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 700 MHz QCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 700 MHz QCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 700 MHz QCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 500 MHz TXI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 900 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 900 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 700 MHz QCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 900 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 900 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 900 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 140 uM [U-100% 13C; U-100% 15N] C39 peptidase domain, 255 uM CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C39 peptidase domain | [U-100% 13C; U-100% 15N] | 140 uM | |
2 | CtA(5-37) peptide | natural abundance | 255 uM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 800 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 800 MHz TXI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 800 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 800 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 800 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 800 MHz TXI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 800 MHz TXI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 800 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE - 800 MHz TXI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Bruker AVANCE III HD - 800 MHz TCI CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 298 uM C39 peptidase domain, 184 uM [U-100% 13C; U-100% 15N] CtA(5-37) peptide, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C39 peptidase domain | natural abundance | 298 uM | |
7 | CtA(5-37) peptide | [U-100% 13C; U-100% 15N] | 184 uM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 5 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30950_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SNAMLRRLFKKKYVCVRQYDLTDAGAACLSSIAQYYGLKMSLAKIREMTGTDTQGTNAYGLIHAAKQLGFSAKGVKASKEDLLKDFRLPAIANVIVDNRL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NAMLRRLFKKKYVCVRQYDLTDAGAACLSSIAQYYGLKMSLAKIREMTGTDTQGTNAYGLIHAAKQLGFSAKGVKASKEDLLKDFRLPAIANVIVDNRL -------110-------120-------130-------140-------150- AHFVVIYSIKNRIITVADPGKGIVRYSMDDFCSIWTGGLVLLEPGEAFQKG ||||||||||||||||||||||||||||||||||||||||||||||||||| AHFVVIYSIKNRIITVADPGKGIVRYSMDDFCSIWTGGLVLLEPGEAFQKG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 908 | 827 | 91.1 |
13C chemical shifts | 690 | 633 | 91.7 |
15N chemical shifts | 167 | 154 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 312 | 297 | 95.2 |
13C chemical shifts | 302 | 294 | 97.4 |
15N chemical shifts | 148 | 142 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 596 | 530 | 88.9 |
13C chemical shifts | 388 | 339 | 87.4 |
15N chemical shifts | 19 | 12 | 63.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 99 | 97 | 98.0 |
13C chemical shifts | 99 | 97 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 63 | 92.6 |
13C chemical shifts | 67 | 41 | 61.2 |
15N chemical shifts | 1 | 1 | 100.0 |