BMRBj - BMREntryMaster

Found 1 Document (4.506 seconds)

BMRB: 31059

8ORG

Tau (297-391) in vitro untwisted fibril

Authors

Duan, P., Dregni, A.J., Mammeri, N.E., Hong, M.

Assembly

Isoform Tau-F of Microtubule-associated protein tau

Entity

1. Isoform Tau-F of Microtubule-associated protein tau (polymer), 95 monomers, 10165.43 × 5 Da Detail

IKHVPGGGSV QIVYKPVDLS KVTSKCGSLG NIHHKPGGGQ VEVKSEKLDF KDRVQSKIGS LDNITHVPGG GNKKIETHKL TFRENAKAKT DHGAE

Total weight

50827.15 Da

Max. entity weight

10165.43 Da

Source organism

Homo sapiens

Exptl. method

solid-state NMR

Data set

assigned_chemical_shifts

Chemcal Shifts

¹³C: 233, ¹⁵N: 51 assignments Detail

ID	Entity ID	Seq ID	Comp ID	Atom ID	Atom type	Val	Val err	Ambig. code
1	1	9	SER	C	C	171.798	0.028	1
2	1	9	SER	CA	C	56.432	0.140	1
3	1	9	SER	CB	C	62.896	0.144	1
4	1	9	SER	N	N	116.880	0.140	1
5	1	10	VAL	C	C	172.728	0.061	1
6	1	10	VAL	CA	C	59.783	0.047	1
7	1	10	VAL	CB	C	33.998	0.090	1
8	1	10	VAL	CG1	C	19.055	0.085	1
9	1	10	VAL	N	N	122.898	0.099	1
10	1	11	GLN	C	C	171.834	0.061	1
11	1	11	GLN	CA	C	52.428	0.048	1
12	1	11	GLN	CB	C	31.055	0.064	1
13	1	11	GLN	CG	C	32.691	0.094	1
14	1	11	GLN	CD	C	177.294	0.074	1
15	1	11	GLN	N	N	129.652	0.079	1
16	1	12	ILE	CA	C	58.129	0.104	1
17	1	12	ILE	CB	C	39.089	0.100	1
18	1	12	ILE	CG1	C	25.408	0.071	1
19	1	12	ILE	CG2	C	14.917	0.078	1
20	1	12	ILE	CD1	C	12.596	0.072	1
21	1	12	ILE	N	N	126.951	0.122	1
22	1	13	VAL	C	C	170.540	0.071	1
23	1	13	VAL	CA	C	59.409	0.059	1
24	1	13	VAL	CB	C	32.002	0.075	1
25	1	13	VAL	CG1	C	19.487	0.054	2
26	1	13	VAL	CG2	C	17.962	0.059	2
27	1	13	VAL	N	N	128.144	0.104	1
28	1	14	TYR	C	C	170.969	0.072	1
29	1	14	TYR	CA	C	55.149	0.080	1
30	1	14	TYR	CB	C	37.989	0.061	1
31	1	14	TYR	CG	C	124.839	0.053	1
32	1	14	TYR	CD1	C	132.496	0.137	1
33	1	14	TYR	CD2	C	132.496	0.137	1
34	1	14	TYR	CE1	C	115.554	0.000	1
35	1	14	TYR	CE2	C	115.554	0.000	1
36	1	14	TYR	CZ	C	155.560	0.085	1
37	1	14	TYR	N	N	132.262	0.057	1
38	1	15	LYS	C	C	169.274	0.042	1
39	1	15	LYS	CA	C	52.020	0.053	1
40	1	15	LYS	CB	C	32.696	0.075	1
41	1	15	LYS	CG	C	22.767	0.052	1
42	1	15	LYS	CD	C	28.381	0.050	1
43	1	15	LYS	CE	C	40.029	0.073	1
44	1	15	LYS	N	N	124.958	0.073	1
45	1	16	PRO	C	C	172.945	0.060	1
46	1	16	PRO	CA	C	61.533	0.054	1
47	1	16	PRO	CB	C	30.928	0.063	1
48	1	16	PRO	CG	C	25.560	0.067	1
49	1	16	PRO	CD	C	48.889	0.047	1
50	1	16	PRO	N	N	135.873	0.081	1
51	1	17	VAL	C	C	172.638	0.083	1
52	1	17	VAL	CA	C	59.563	0.069	1
53	1	17	VAL	CB	C	33.659	0.101	1
54	1	17	VAL	CG1	C	19.675	0.065	2
55	1	17	VAL	CG2	C	18.890	0.066	2
56	1	17	VAL	N	N	119.813	0.104	1
57	1	18	ASP	C	C	171.568	0.089	1
58	1	18	ASP	CA	C	51.179	0.040	1
59	1	18	ASP	CB	C	43.884	0.108	1
60	1	18	ASP	CG	C	179.858	0.092	1
61	1	18	ASP	N	N	127.988	0.087	1
62	1	19	LEU	C	C	171.316	0.053	1
63	1	19	LEU	CA	C	51.135	0.052	1
64	1	19	LEU	CB	C	43.279	0.071	1
65	1	19	LEU	CG	C	25.638	0.068	1
66	1	19	LEU	CD1	C	23.726	0.087	1
67	1	19	LEU	N	N	124.048	0.097	1
68	1	20	SER	C	C	172.557	0.081	1
69	1	20	SER	CA	C	53.983	0.067	1
70	1	20	SER	CB	C	63.232	0.136	1
71	1	20	SER	N	N	120.497	0.092	1
72	1	21	LYS	C	C	172.111	0.048	1
73	1	21	LYS	CA	C	52.758	0.054	1
74	1	21	LYS	CB	C	35.169	0.012	1
75	1	21	LYS	CG	C	23.448	0.142	1
76	1	21	LYS	CD	C	28.322	0.057	1
77	1	21	LYS	CE	C	39.994	0.064	1
78	1	21	LYS	N	N	122.656	0.036	1
79	1	22	VAL	C	C	173.408	0.069	1
80	1	22	VAL	CA	C	59.038	0.065	1
81	1	22	VAL	CB	C	33.511	0.066	1
82	1	22	VAL	CG1	C	20.276	0.054	2
83	1	22	VAL	CG2	C	19.873	0.050	2
84	1	22	VAL	N	N	124.637	0.073	1
85	1	23	THR	C	C	170.929	0.057	1
86	1	23	THR	CA	C	59.508	0.059	1
87	1	23	THR	CB	C	67.791	0.078	1
88	1	23	THR	CG2	C	19.559	0.058	1
89	1	23	THR	N	N	127.357	0.095	1
90	1	24	SER	C	C	170.523	0.046	1
91	1	24	SER	CA	C	53.283	0.055	1
92	1	24	SER	CB	C	63.789	0.077	1
93	1	24	SER	N	N	122.024	0.131	1
94	1	25	LYS	C	C	175.510	0.050	1
95	1	25	LYS	CA	C	52.977	0.048	1
96	1	25	LYS	CB	C	35.539	0.058	1
97	1	25	LYS	CG	C	23.681	0.085	1
98	1	25	LYS	CD	C	27.774	0.135	1
99	1	25	LYS	CE	C	40.012	0.062	1
100	1	25	LYS	N	N	123.393	0.078	1
101	1	26	CYS	C	C	170.695	0.098	1
102	1	26	CYS	CA	C	57.889	0.110	1
103	1	26	CYS	CB	C	22.764	0.079	1
104	1	26	CYS	N	N	123.711	0.076	1
105	1	27	GLY	C	C	172.097	0.067	1
106	1	27	GLY	CA	C	45.583	0.075	1
107	1	27	GLY	N	N	115.012	0.153	1
108	1	28	SER	C	C	170.976	0.044	1
109	1	28	SER	CA	C	56.534	0.099	1
110	1	28	SER	CB	C	64.895	0.064	1
111	1	28	SER	N	N	112.646	0.137	1
112	1	29	LEU	C	C	175.540	0.041	1
113	1	29	LEU	CA	C	53.282	0.057	1
114	1	29	LEU	CB	C	44.783	0.104	1
115	1	29	LEU	CG	C	27.731	0.061	1
116	1	29	LEU	CD1	C	23.599	0.041	1
117	1	29	LEU	N	N	118.248	0.062	1
118	1	30	GLY	C	C	168.144	0.053	1
119	1	30	GLY	CA	C	43.121	0.104	1
120	1	30	GLY	N	N	107.028	0.119	1
121	1	31	ASN	C	C	171.301	0.087	1
122	1	31	ASN	CA	C	50.523	0.092	1
123	1	31	ASN	CB	C	41.283	0.146	1
124	1	31	ASN	CG	C	173.619	0.017	1
125	1	31	ASN	N	N	125.912	0.128	1
126	1	32	ILE	C	C	174.103	0.045	1
127	1	32	ILE	CA	C	58.731	0.072	1
128	1	32	ILE	CB	C	42.170	0.139	1
129	1	32	ILE	CG1	C	26.307	0.070	1
130	1	32	ILE	CG2	C	15.377	0.054	1
131	1	32	ILE	CD1	C	13.664	0.088	1
132	1	32	ILE	N	N	120.299	0.068	1
133	1	33	HIS	CB	C	28.426	0.041	1
134	1	33	HIS	N	N	130.983	0.041	1
135	1	34	HIS	C	C	169.548	0.079	1
136	1	34	HIS	CA	C	53.630	0.084	1
137	1	34	HIS	CB	C	30.590	0.126	1
138	1	34	HIS	CG	C	134.462	0.174	1
139	1	34	HIS	CD2	C	114.031	0.127	1
140	1	35	LYS	C	C	168.632	0.021	1
141	1	35	LYS	CA	C	55.086	0.093	1
142	1	35	LYS	CB	C	30.495	0.068	1
143	1	35	LYS	CG	C	23.673	0.082	1
144	1	35	LYS	CD	C	27.851	0.079	1
145	1	35	LYS	CE	C	39.548	0.125	1
146	1	35	LYS	N	N	128.975	0.083	1
147	1	36	PRO	C	C	175.103	0.119	1
148	1	36	PRO	CA	C	61.559	0.047	1
149	1	36	PRO	CB	C	30.472	0.075	1
150	1	36	PRO	CG	C	27.180	0.090	1
151	1	36	PRO	CD	C	47.611	0.078	1
152	1	37	GLY	C	C	173.155	0.071	1
153	1	37	GLY	CA	C	43.012	0.073	1
154	1	37	GLY	N	N	111.134	0.086	1
155	1	38	GLY	C	C	174.744	0.057	1
156	1	38	GLY	CA	C	42.104	0.063	1
157	1	38	GLY	N	N	111.247	0.045	1
158	1	39	GLY	C	C	171.243	0.066	1
159	1	39	GLY	CA	C	42.182	0.050	1
160	1	39	GLY	N	N	106.955	0.128	1
161	1	40	GLN	C	C	170.768	0.057	1
162	1	40	GLN	CA	C	54.600	0.064	1
163	1	40	GLN	CB	C	25.627	0.076	1
164	1	40	GLN	CG	C	28.129	0.072	1
165	1	40	GLN	CD	C	174.483	0.033	1
166	1	40	GLN	N	N	122.247	0.090	1
167	1	41	VAL	C	C	171.531	0.068	1
168	1	41	VAL	CA	C	59.350	0.068	1
169	1	41	VAL	CB	C	34.065	0.101	1
170	1	41	VAL	CG1	C	18.970	0.084	2
171	1	41	VAL	CG2	C	18.776	0.025	2
172	1	41	VAL	N	N	119.426	0.075	1
173	1	42	GLU	C	C	171.534	0.074	1
174	1	42	GLU	CA	C	52.266	0.047	1
175	1	42	GLU	CB	C	30.668	0.090	1
176	1	42	GLU	CG	C	32.730	0.058	1
177	1	42	GLU	N	N	131.521	0.096	1
178	1	43	VAL	C	C	173.210	0.056	1
179	1	43	VAL	CA	C	57.714	0.070	1
180	1	43	VAL	CB	C	32.212	0.072	1
181	1	43	VAL	CG1	C	19.657	0.080	2
182	1	43	VAL	CG2	C	19.091	0.058	2
183	1	43	VAL	N	N	127.450	0.083	1
184	1	44	LYS	C	C	172.942	0.054	1
185	1	44	LYS	CA	C	52.479	0.067	1
186	1	44	LYS	CB	C	36.038	0.042	1
187	1	44	LYS	CG	C	22.036	0.071	1
188	1	44	LYS	CD	C	29.661	0.057	1
189	1	44	LYS	CE	C	40.125	0.070	1
190	1	44	LYS	N	N	115.697	0.096	1
191	1	45	SER	C	C	170.394	0.060	1
192	1	45	SER	CA	C	54.768	0.057	1
193	1	45	SER	CB	C	62.670	0.057	1
194	1	45	SER	N	N	112.047	0.083	1
195	1	46	GLU	C	C	173.172	0.067	1
196	1	46	GLU	CA	C	53.352	0.040	1
197	1	46	GLU	CB	C	31.778	0.062	1
198	1	46	GLU	CG	C	32.818	0.084	1
199	1	46	GLU	CD	C	179.423	0.057	1
200	1	46	GLU	N	N	132.420	0.090	1
201	1	47	LYS	C	C	171.908	0.054	1
202	1	47	LYS	CA	C	53.411	0.038	1
203	1	47	LYS	CB	C	33.918	0.066	1
204	1	47	LYS	CG	C	23.465	0.081	1
205	1	47	LYS	CD	C	28.077	0.063	1
206	1	47	LYS	CE	C	42.938	0.087	1
207	1	47	LYS	N	N	130.606	0.107	1
208	1	48	LEU	C	C	172.541	0.048	1
209	1	48	LEU	CA	C	52.958	0.072	1
210	1	48	LEU	CB	C	42.801	0.028	1
211	1	48	LEU	CG	C	28.322	0.071	1
212	1	48	LEU	CD1	C	24.368	0.050	2
213	1	48	LEU	CD2	C	22.406	0.137	2
214	1	48	LEU	N	N	127.318	0.101	1
215	1	49	ASP	C	C	172.578	0.000	1
216	1	49	ASP	CA	C	51.111	0.077	1
217	1	49	ASP	CB	C	42.725	0.067	1
218	1	49	ASP	CG	C	178.529	0.090	1
219	1	49	ASP	N	N	123.954	0.132	1
220	1	50	PHE	C	C	172.892	0.018	1
221	1	50	PHE	CA	C	53.930	0.144	1
222	1	50	PHE	CB	C	39.628	0.000	1
223	1	50	PHE	CG	C	134.781	0.083	1
224	1	51	LYS	C	C	174.001	0.080	1
225	1	51	LYS	CA	C	52.854	0.047	1
226	1	51	LYS	CB	C	31.147	0.082	1
227	1	51	LYS	CG	C	22.759	0.060	1
228	1	51	LYS	CD	C	28.110	0.123	1
229	1	51	LYS	N	N	128.540	0.079	1
230	1	52	ASP	C	C	175.468	0.092	1
231	1	52	ASP	CA	C	53.168	0.059	1
232	1	52	ASP	CB	C	39.953	0.087	1
233	1	52	ASP	N	N	124.723	0.111	1
234	1	53	ARG	C	C	171.328	0.062	1
235	1	53	ARG	CA	C	53.329	0.043	1
236	1	53	ARG	CB	C	30.326	0.044	1
237	1	53	ARG	CG	C	26.162	0.054	1
238	1	53	ARG	CD	C	41.953	0.069	1
239	1	53	ARG	CZ	C	157.356	0.078	1
240	1	53	ARG	N	N	120.284	0.118	1
241	1	53	ARG	NE	N	84.902	0.073	1
242	1	54	VAL	C	C	172.543	0.058	1
243	1	54	VAL	CA	C	59.063	0.072	1
244	1	54	VAL	CB	C	30.328	0.139	1
245	1	54	VAL	CG1	C	20.330	0.042	2
246	1	54	VAL	CG2	C	18.660	0.038	2
247	1	54	VAL	N	N	128.644	0.095	1
248	1	55	GLN	C	C	171.079	0.055	1
249	1	55	GLN	CA	C	51.932	0.043	1
250	1	55	GLN	CB	C	32.597	0.063	1
251	1	55	GLN	CG	C	27.510	0.022	1
252	1	55	GLN	CD	C	177.876	0.092	1
253	1	55	GLN	N	N	121.805	0.080	1
254	1	56	SER	C	C	172.601	0.074	1
255	1	56	SER	CA	C	53.942	0.079	1
256	1	56	SER	CB	C	63.316	0.071	1
257	1	56	SER	N	N	117.874	0.092	1
258	1	57	LYS	C	C	172.212	0.061	1
259	1	57	LYS	CA	C	53.473	0.058	1
260	1	57	LYS	CB	C	33.698	0.095	1
261	1	57	LYS	CG	C	23.680	0.073	1
262	1	57	LYS	CD	C	28.007	0.063	1
263	1	57	LYS	CE	C	40.825	0.096	1
264	1	57	LYS	N	N	132.695	0.100	1
265	1	58	ILE	C	C	175.305	0.078	1
266	1	58	ILE	CA	C	57.119	0.058	1
267	1	58	ILE	CB	C	40.767	0.063	1
268	1	58	ILE	CG1	C	25.289	0.086	1
269	1	58	ILE	CG2	C	15.918	0.047	1
270	1	58	ILE	CD1	C	12.466	0.083	1
271	1	58	ILE	N	N	125.569	0.111	1
272	1	59	GLY	C	C	171.720	0.021	1
273	1	59	GLY	CA	C	46.692	0.120	1
274	1	59	GLY	N	N	118.634	0.120	1
275	1	60	SER	C	C	169.213	0.039	1
276	1	60	SER	CA	C	54.361	0.095	1
277	1	60	SER	CB	C	63.866	0.076	1
278	1	60	SER	N	N	115.498	0.108	1
279	1	61	LEU	CA	C	52.295	0.041	1
280	1	61	LEU	CB	C	43.482	0.085	1
281	1	61	LEU	CG	C	27.375	0.075	1
282	1	61	LEU	CD1	C	23.885	0.044	2
283	1	61	LEU	CD2	C	22.791	0.054	2
284	1	61	LEU	N	N	129.010	0.216	1

Release date

2022-12-11

Citation

Structure of Untwisted Filaments of a Tiny Tau that Encompasses the Alzheimer's Tau b-sheet Core
Duan, P., Dregni, A.J., Mammeri, N.E., Hong, M.

Related entities 1. Isoform Tau-F of Microtubule-associated protein tau, : 1 : 111 : 1 : 3 : 31 entities Detail

Interaction partners 1. Isoform Tau-F of Microtubule-associated protein tau, : 18 interactors Detail

More details for 18 interactors identified by 8 citations

Experiments performed 7 experiments Detail

1 2D 13C-detected NCACB

Instrument

Bruker AVANCE NEO - 900 MHz

Sample

State isotropic, Solvent system 10 mM potassium phosphate, Pressure 1 atm, Temperature 287 (±3) K, pH 5.5 (±0.5), Details 50 % w/w [U-100% 13C; U-100% 15N] Tau (297-391), 200 mM MgCl2, 10 mM potassium phosphate

#	Name	Isotope labeling	Type	Concentration
1	Tau (297-391)	[U-100% 13C; U-100% 15N]		50 % w/w
2	MgCl2	natural abundance		200 mM

2 3D NCACX

Instrument

Bruker AVANCE NEO - 900 MHz

Sample

#	Name	Isotope labeling	Type	Concentration
1	Tau (297-391)	[U-100% 13C; U-100% 15N]		50 % w/w
2	MgCl2	natural abundance		200 mM

3 3D NCOCX

Instrument

Bruker AVANCE NEO - 900 MHz

Sample

#	Name	Isotope labeling	Type	Concentration
1	Tau (297-391)	[U-100% 13C; U-100% 15N]		50 % w/w
2	MgCl2	natural abundance		200 mM

4 3D CONCACB

Instrument

Bruker AVANCE NEO - 900 MHz

Sample

#	Name	Isotope labeling	Type	Concentration
1	Tau (297-391)	[U-100% 13C; U-100% 15N]		50 % w/w
2	MgCl2	natural abundance		200 mM

5 2D 13C-detected CORD

Instrument

Bruker AVANCE - 800 MHz

Sample

State isotropic, Solvent system 10 mM potassium phosphate, Pressure 1 atm, Temperature 287 (±3) K, pH 5.5 (±0.5), Details 50 % w/w 50% UCN diluted with NA Tau (297-391), 200 mM MgCl2, 10 mM potassium phosphate

#	Name	Isotope labeling	Type	Concentration
3	Tau (297-391)	50% UCN diluted with NA		50 % w/w
4	MgCl2	natural abundance		200 mM

6 2D 13C-detected long, CORD

Instrument

Bruker AVANCE - 800 MHz

Sample

#	Name	Isotope labeling	Type	Concentration
3	Tau (297-391)	50% UCN diluted with NA		50 % w/w
4	MgCl2	natural abundance		200 mM

7 2D 13C-detected long, CORD

Instrument

Bruker AVANCE - 800 MHz

Sample

State isotropic, Solvent system 10 mM potassium phosphate, Pressure 1 atm, Temperature 287 (±3) K, pH 5.5 (±0.5), Details 50 % w/w [1,3-13C]glycerol, U-15N Tau (297-391), 200 mM MgCl2, 10 mM potassium phosphate

#	Name	Isotope labeling	Type	Concentration
5	Tau (297-391)	[1,3-13C]glycerol, U-15N		50 % w/w
6	MgCl2	natural abundance		200 mM

Chemical shift validation 3 contents Detail

Properties

Input source #1: Assigned chemical shifts - Assigned chemical shifts	bmr31059_3.str
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Content subtype: bmr31059_3.str

#	Content subtype	Saveframe	Status	# of rows	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chemical_shifts_1	Warning	284		55.8 (chain: 1, length: 95)
1	Chemical shift references	chem_shift_reference_1	OK	2		No information

Assigned chemical shifts

Saveframe: assigned_chemical_shifts_1

Status: Warning

Sequence coverage of experimental data

Entity_assembly_ID: 1, Chain length: 95, Sequence coverage: 55.8%

--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
        |||||||||||||||||||||||||||||||||||||||||||||||||||||                                  
........SVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSL                                  
--------10--------20--------30--------40--------50--------60-

Total number of assignments
- ¹³C chemical shifts: 233
- ¹⁵N chemical shifts: 51

Completeness of assignments

Entity_assemble_ID: 1

Excluded Atom_ID in statistics

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
11	GLN	CD	177.294
14	TYR	CG	124.839
14	TYR	CZ	155.56
16	PRO	N	135.873
18	ASP	CG	179.858
31	ASN	CG	173.619
34	HIS	CG	134.462
40	GLN	CD	174.483
46	GLU	CD	179.423
49	ASP	CG	178.529
50	PHE	CG	134.781
53	ARG	CZ	157.356
55	GLN	CD	177.876

All atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	416	221	53.1
¹⁵N chemical shifts	100	50	50.0

Backbone atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	190	102	53.7
¹⁵N chemical shifts	91	49	53.8

Side chain atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	226	119	52.7
¹⁵N chemical shifts	9	1	11.1

Methyl group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	48	26	54.2

Aromatic group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	26	5	19.2

Redox state of CYS
Peptide bond of PRO
Tautomeric state of HIS
Rotameric state of ILE , LEU, and VAL
Histogram of normalized assigned chemical shifts
Random coil index and derived parameters (S² and NMR RMSD)
- Chain_ID: 1

Keywords 3-layer structure, AD tau core, PROTEIN FIBRIL, untwisted filament

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (4.506 seconds)

BMRB: 31059

Related entities 1. Isoform Tau-F of Microtubule-associated protein tau, : 1 : 111 : 1 : 3 : 31 entities Detail

Interaction partners 1. Isoform Tau-F of Microtubule-associated protein tau, : 18 interactors Detail

Experiments performed 7 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Chemical shift validation 3 contents Detail