S-nitrosylated 3D NMR structure of the cytoplasmic rhodanese domain of the inner membrane protein YgaP from Escherichia coli
ALTTISPHDA QELIARGAKL IDIRDADEYL REHIPEADLA PLSVLEQSGL PAKLRHEQII FHCQAGKRTS NNADKLAAIA APAEIFLLED GIDGWKKAGL PVAVNKSQ
Polymer type: polypeptide(L)
Total | 1H | 13C | |
---|---|---|---|
All | 75.1 % (837 of 1115) | 81.6 % (519 of 636) | 66.4 % (318 of 479) |
Backbone | 72.8 % (389 of 534) | 88.9 % (192 of 216) | 61.9 % (197 of 318) |
Sidechain | 78.5 % (536 of 683) | 77.9 % (327 of 420) | 79.5 % (209 of 263) |
Aromatic | 43.6 % (24 of 55) | 57.1 % (16 of 28) | 29.6 % (8 of 27) |
Methyl | 94.4 % (136 of 144) | 94.4 % (68 of 72) | 94.4 % (68 of 72) |
1. entity 1
ALTTISPHDA QELIARGAKL IDIRDADEYL REHIPEADLA PLSVLEQSGL PAKLRHEQII FHCQAGKRTS NNADKLAAIA APAEIFLLED GIDGWKKAGL PVAVNKSQSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details 1 mM [U-99% 13C; U-99% 15N] S-nitrosylated rhodanese domain, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S-nitrosylated rhodanese domain | [U-99% 13C; U-99% 15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details 1 mM [U-99% 13C; U-99% 15N] S-nitrosylated rhodanese domain, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S-nitrosylated rhodanese domain | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details 1 mM [U-99% 13C; U-99% 15N] S-nitrosylated rhodanese domain, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S-nitrosylated rhodanese domain | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details 1 mM [U-99% 13C; U-99% 15N] S-nitrosylated rhodanese domain, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S-nitrosylated rhodanese domain | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details 1 mM [U-99% 13C; U-99% 15N] S-nitrosylated rhodanese domain, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S-nitrosylated rhodanese domain | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details 1 mM [U-99% 13C; U-99% 15N] S-nitrosylated rhodanese domain, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S-nitrosylated rhodanese domain | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details 1 mM [U-99% 13C; U-99% 15N] S-nitrosylated rhodanese domain, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S-nitrosylated rhodanese domain | [U-99% 13C; U-99% 15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_34010_5lao.nef |
Input source #2: Coordindates | 5lao.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGL -------- PVAVNKSQ |||||||| PVAVNKSQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_34010_5lao.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGL ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| |||||||||| ALTTI.PHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHC.AGKRTSNNADKLAAIAAPAEIFLL..GIDGWKKAGL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- PVAVNKSQ ||||| | PVAVN.S -------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 636 | 515 | 81.0 |
13C chemical shifts | 479 | 310 | 64.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 216 | 194 | 89.8 |
13C chemical shifts | 216 | 99 | 45.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 420 | 321 | 76.4 |
13C chemical shifts | 263 | 211 | 80.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 69 | 95.8 |
13C chemical shifts | 72 | 70 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 16 | 57.1 |
13C chemical shifts | 27 | 8 | 29.6 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGL |||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| ALTTIS.HDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHC.AGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- PVAVNKSQ ||||| PVAVN -----