Lactococcin A immunity protein
MSGSHHHHHH SSGIEGRGRM KKKQIEFENE LRSMLATALE KDISQEERNA LNIAEKALDN SEYLPKIILN LRKALTPLAI NRTLNHDLSE LYKFITSSKA SNKNLGGGLI MSWGRLF
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.8 % (997 of 1388) | 67.8 % (494 of 729) | 75.8 % (403 of 532) | 78.7 % (100 of 127) |
Backbone | 77.9 % (544 of 698) | 73.8 % (177 of 240) | 80.2 % (275 of 343) | 80.0 % (92 of 115) |
Sidechain | 67.8 % (542 of 799) | 64.8 % (317 of 489) | 72.8 % (217 of 298) | 66.7 % (8 of 12) |
Aromatic | 50.0 % (43 of 86) | 51.2 % (22 of 43) | 47.6 % (20 of 42) | 100.0 % (1 of 1) |
Methyl | 90.3 % (112 of 124) | 90.3 % (56 of 62) | 90.3 % (56 of 62) |
1. entity 1
MSGSHHHHHH SSGIEGRGRM KKKQIEFENE LRSMLATALE KDISQEERNA LNIAEKALDN SEYLPKIILN LRKALTPLAI NRTLNHDLSE LYKFITSSKA SNKNLGGGLI MSWGRLFSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.5 mM [U-100% 13C; U-100% 15N] lactococcin A immunity protein, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lactococcin A immunity protein | [U-100% 13C; U-100% 15N] | 0.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34018_5lfi.nef |
Input source #2: Coordindates | 5lfi.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSGSHHHHHHSSGIEGRGRMKKKQIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITSSKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSGSHHHHHHSSGIEGRGRMKKKQIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITSSKA -------110------- SNKNLGGGLIMSWGRLF ||||||||||||||||| SNKNLGGGLIMSWGRLF
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 117 | 0 | 0 | 100.0 |
Content subtype: combined_34018_5lfi.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSGSHHHHHHSSGIEGRGRMKKKQIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITSSKA ||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ...........SGIEGRGRM...QIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITS..A -------110------- SNKNLGGGLIMSWGRLF |||||||||||||| ...NLGGGLIMSWGRLF
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 532 | 394 | 74.1 |
1H chemical shifts | 729 | 476 | 65.3 |
15N chemical shifts | 134 | 98 | 73.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 234 | 183 | 78.2 |
1H chemical shifts | 240 | 173 | 72.1 |
15N chemical shifts | 115 | 90 | 78.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 298 | 211 | 70.8 |
1H chemical shifts | 489 | 303 | 62.0 |
15N chemical shifts | 19 | 8 | 42.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 66 | 56 | 84.8 |
1H chemical shifts | 66 | 57 | 86.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 42 | 19 | 45.2 |
1H chemical shifts | 43 | 21 | 48.8 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSGSHHHHHHSSGIEGRGRMKKKQIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITSSKA || ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||| | .............IE........QIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYL.KIILNLRKALTPLAINRTLNHDLSELYKFITS..A --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------- SNKNLGGGLIMSWGRLF | | ....L....I -------110
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSGSHHHHHHSSGIEGRGRMKKKQIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITSSKA |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .................GRMK..QIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITS --------10--------20--------30--------40--------50--------60--------70--------80--------90------- -------110------- SNKNLGGGLIMSWGRLF