NMR solution structure of human FNIII domain 2 of NCAM
MQPVREPSAP KLEGQMGEDG NSIKVNLIKQ DDGGSPIRHY LVRYRALSSE WKPEIRLPSG SDHVMLKSLD WNAEYEVYVV AENQQGKSKA AHFVFRTHHH HHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.4 % (1027 of 1217) | 90.5 % (578 of 639) | 73.8 % (347 of 470) | 94.4 % (102 of 108) |
Backbone | 79.7 % (483 of 606) | 92.3 % (191 of 207) | 66.6 % (201 of 302) | 93.8 % (91 of 97) |
Sidechain | 89.8 % (635 of 707) | 89.6 % (387 of 432) | 89.8 % (237 of 264) | 100.0 % (11 of 11) |
Aromatic | 71.4 % (80 of 112) | 71.4 % (40 of 56) | 70.4 % (38 of 54) | 100.0 % (2 of 2) |
Methyl | 98.9 % (89 of 90) | 97.8 % (44 of 45) | 100.0 % (45 of 45) |
1. Neural cell adhesion molecule 1
MQPVREPSAP KLEGQMGEDG NSIKVNLIKQ DDGGSPIRHY LVRYRALSSE WKPEIRLPSG SDHVMLKSLD WNAEYEVYVV AENQQGKSKA AHFVFRTHHH HHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.45, Details 0.9 mM [U-99% 13C; U-99% 15N] fibronectin type III domain 2, 20 mM TBS, 150 mM sodium chloride, 10 % [U-2H] D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fibronectin type III domain 2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | TBS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34026_5lkn.nef |
Input source #2: Coordindates | 5lkn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---600-------610-------620-------630-------640-------650-------660-------670-------680-------690---- MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --- HHH ||| HHH ---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 103 | 0 | 0 | 100.0 |
Content subtype: combined_34026_5lkn.nef
Assigned chemical shifts
---600-------610-------620-------630-------640-------650-------660-------670-------680-------690---- MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHH ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQPVREPSAPKLEGQ.GEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHH ---600-------610-------620-------630-------640-------650-------660-------670-------680-------690--- --- HHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 639 | 580 | 90.8 |
13C chemical shifts | 470 | 331 | 70.4 |
15N chemical shifts | 114 | 101 | 88.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 207 | 192 | 92.8 |
13C chemical shifts | 206 | 95 | 46.1 |
15N chemical shifts | 97 | 90 | 92.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 432 | 388 | 89.8 |
13C chemical shifts | 264 | 236 | 89.4 |
15N chemical shifts | 17 | 11 | 64.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 47 | 97.9 |
13C chemical shifts | 48 | 47 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 40 | 71.4 |
13C chemical shifts | 54 | 38 | 70.4 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
---600-------610-------620-------630-------640-------650-------660-------670-------680-------690---- MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHH ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQPVREPSAPKLEGQ.GEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHH ---600-------610-------620-------630-------640-------650-------660-------670-------680-------690--- --- HHH
Dihedral angle restraints
---600-------610-------620-------630-------640-------650-------660-------670-------680-------690---- MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||| ..PVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLP..SDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTH ---600-------610-------620-------630-------640-------650-------660-------670-------680-------690-- --- HHH