Spatial structure of the lentil lipid transfer protein in complex with anionic lysolipid LPPG
AISCGAVTSD LSPCLTYLTG GPGPSPQCCG GVKKLLAAAN TTPDRQAACN CLKSAAGSIT KLNTNNAAAL PGKCGVNIPY KISTTTNCNT VKF
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.5 % (954 of 969) | 99.8 % (495 of 496) | 96.6 % (364 of 377) | 99.0 % (95 of 96) |
Backbone | 98.3 % (535 of 544) | 99.5 % (187 of 188) | 97.4 % (263 of 270) | 98.8 % (85 of 86) |
Sidechain | 98.8 % (503 of 509) | 100.0 % (308 of 308) | 96.9 % (185 of 191) | 100.0 % (10 of 10) |
Aromatic | 76.9 % (20 of 26) | 100.0 % (13 of 13) | 53.8 % (7 of 13) | |
Methyl | 100.0 % (110 of 110) | 100.0 % (55 of 55) | 100.0 % (55 of 55) |
1. entity 1
AISCGAVTSD LSPCLTYLTG GPGPSPQCCG GVKKLLAAAN TTPDRQAACN CLKSAAGSIT KLNTNNAAAL PGKCGVNIPY KISTTTNCNT VKFSolvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 303 K, pH 5.6, Details 0.3 mM [U-99% 13C; U-99% 15N] LTP2, 2 mM LPPG, 20 mM sodium acetate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LPPG | natural abundance | 2 mM | |
2 | LTP2 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
3 | sodium acetate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.01 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 303 K, pH 5.6, Details 0.3 mM [U-99% 13C; U-99% 15N] LTP2, 2 mM LPPG, 20 mM sodium acetate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LPPG | natural abundance | 2 mM | |
2 | LTP2 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
3 | sodium acetate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.01 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 303 K, pH 5.6, Details 0.3 mM [U-99% 13C; U-99% 15N] LTP2, 2 mM LPPG, 20 mM sodium acetate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LPPG | natural abundance | 2 mM | |
2 | LTP2 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
3 | sodium acetate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.01 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 303 K, pH 5.6, Details 0.3 mM [U-99% 13C; U-99% 15N] LTP2, 2 mM LPPG, 20 mM sodium acetate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LPPG | natural abundance | 2 mM | |
2 | LTP2 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
3 | sodium acetate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.01 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 303 K, pH 5.6, Details 0.3 mM [U-99% 13C; U-99% 15N] LTP2, 2 mM LPPG, 20 mM sodium acetate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LPPG | natural abundance | 2 mM | |
2 | LTP2 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
3 | sodium acetate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.01 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 303 K, pH 5.6, Details 0.3 mM [U-99% 13C; U-99% 15N] LTP2, 2 mM LPPG, 20 mM sodium acetate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LPPG | natural abundance | 2 mM | |
2 | LTP2 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
3 | sodium acetate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.01 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34036_5lqv.nef |
Input source #2: Coordindates | 5lqv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | PGM | 1-MYRISTOYL-2-HYDROXY-SN-GLYCERO-3-[PHOSPHO-RAC-(1-GLYCEROL)] | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 93 | 0 | 0 | 100.0 |
Content subtype: combined_34036_5lqv.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
3 | SER | HG | 4.754 |
16 | THR | HG1 | 4.754 |
25 | SER | HG | 6.045 |
45 | ARG | HH21 | 6.758 |
45 | ARG | HH22 | 6.758 |
45 | ARG | NH2 | 72.213 |
60 | THR | HG1 | 4.748 |
84 | THR | HG1 | 4.76 |
85 | THR | HG1 | 5.012 |
92 | LYS | HZ1 | 7.892 |
92 | LYS | HZ2 | 7.892 |
92 | LYS | HZ3 | 7.892 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 496 | 495 | 99.8 |
13C chemical shifts | 377 | 362 | 96.0 |
15N chemical shifts | 97 | 96 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 188 | 187 | 99.5 |
13C chemical shifts | 186 | 177 | 95.2 |
15N chemical shifts | 86 | 85 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 308 | 308 | 100.0 |
13C chemical shifts | 191 | 185 | 96.9 |
15N chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 55 | 100.0 |
13C chemical shifts | 55 | 55 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 13 | 100.0 |
13C chemical shifts | 13 | 7 | 53.8 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||| AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNI.Y.ISTTTNCNTVKF
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF