Salt-inducible protein splicing by inteins from extremely halophilic archaea and application to scarless segmental labeling of TonB protein
SNEFLMKIQT AISSKNRYPK MAQIRGIEGE VLVSFTINAD GSVTDIKVVK SNTTDILNHA ALEAIKSAAH LFPKPEETVH LKIPIAYSLK ED
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.4 % (1014 of 1074) | 95.3 % (530 of 556) | 92.4 % (391 of 423) | 97.9 % (93 of 95) |
Backbone | 96.9 % (527 of 544) | 96.2 % (176 of 183) | 97.1 % (265 of 273) | 97.7 % (86 of 88) |
Sidechain | 92.9 % (575 of 619) | 94.9 % (354 of 373) | 89.5 % (214 of 239) | 100.0 % (7 of 7) |
Aromatic | 56.9 % (33 of 58) | 75.9 % (22 of 29) | 37.9 % (11 of 29) | |
Methyl | 98.4 % (120 of 122) | 96.7 % (59 of 61) | 100.0 % (61 of 61) |
1. Protein TonB
SNEFLMKIQT AISSKNRYPK MAQIRGIEGE VLVSFTINAD GSVTDIKVVK SNTTDILNHA ALEAIKSAAH LFPKPEETVH LKIPIAYSLK EDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 0.5 mM [U-100% 13C; U-100% 15N] TonB CTD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_34043_5lw8.nef |
Input source #2: Coordindates | 5lw8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----200-------210-------220-------230-------240-------250-------260-------270-------280----- SNEFLMKIQTAISSKNRYPKMAQIRGIEGEVLVSFTINADGSVTDIKVVKSNTTDILNHAALEAIKSAAHLFPKPEETVHLKIPIAYSLKED |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNEFLMKIQTAISSKNRYPKMAQIRGIEGEVLVSFTINADGSVTDIKVVKSNTTDILNHAALEAIKSAAHLFPKPEETVHLKIPIAYSLKED --------10--------20--------30--------40--------50--------60--------70--------80--------90--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
Content subtype: combined_34043_5lw8.nef
Assigned chemical shifts
----200-------210-------220-------230-------240-------250-------260-------270-------280----- SNEFLMKIQTAISSKNRYPKMAQIRGIEGEVLVSFTINADGSVTDIKVVKSNTTDILNHAALEAIKSAAHLFPKPEETVHLKIPIAYSLKED ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NEFLMKIQTAISSKNRYPKMAQIRGIEGEVLVSFTINADGSVTDIKVVKSNTTDILNHAALEAIKSAAHLFPKPEETVHLKIPIAYSLKED
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
231 | ASN | CG | 176.799 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 556 | 530 | 95.3 |
13C chemical shifts | 423 | 383 | 90.5 |
15N chemical shifts | 97 | 92 | 94.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 183 | 178 | 97.3 |
13C chemical shifts | 184 | 175 | 95.1 |
15N chemical shifts | 88 | 85 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 373 | 352 | 94.4 |
13C chemical shifts | 239 | 208 | 87.0 |
15N chemical shifts | 9 | 7 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 63 | 100.0 |
13C chemical shifts | 63 | 63 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 22 | 75.9 |
13C chemical shifts | 29 | 11 | 37.9 |
Distance restraints
----200-------210-------220-------230-------240-------250-------260-------270-------280----- SNEFLMKIQTAISSKNRYPKMAQIRGIEGEVLVSFTINADGSVTDIKVVKSNTTDILNHAALEAIKSAAHLFPKPEETVHLKIPIAYSLKED |||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NEFLMKIQTAISSKNRYP.MAQIRGIEGEVLVSFTINADGSVTDIKVVKSNTTDILNHAALEAIKSAAHLFPKPEETVHLKIPIAYSLKED