Solution structure of isolated 15th Fibronectin III domain from human fibronectin
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.8 % (850 of 947) | 97.1 % (471 of 485) | 78.1 % (289 of 370) | 97.8 % (90 of 92) |
Backbone | 84.6 % (430 of 508) | 99.4 % (173 of 174) | 69.4 % (175 of 252) | 100.0 % (82 of 82) |
Sidechain | 96.3 % (500 of 519) | 95.8 % (298 of 311) | 98.0 % (194 of 198) | 80.0 % (8 of 10) |
Aromatic | 89.3 % (50 of 56) | 92.9 % (26 of 28) | 85.2 % (23 of 27) | 100.0 % (1 of 1) |
Methyl | 100.0 % (104 of 104) | 100.0 % (52 of 52) | 100.0 % (52 of 52) |
1. Fibronectin
NASTGQEALS QTTISWAPFQ DTSEYIISCH PVGTDEEPLQ FRVPGTSTSA TLTGLTRGAT YNIIVEALKD QQRHKVREEV VTVGNSSolvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM [U-2H] TRIS, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 150 mM sodium chloride, 1 mM sodium azide, 0.02 ug/mL TSP, 0.5 mM EDTA, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.2) mM | |
10 | EDTA | natural abundance | 0.5 (±0.2) mM | |
11 | TRIS | [U-2H] | 10 (±0.2) mM | |
12 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
13 | sodium azide | natural abundance | 1 (±0.2) mM | |
14 | sodium chloride | natural abundance | 150 (±0.2) mM | |
15 | D2O | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 950 MHz at MRC Crick
State isotropic, Solvent system 100% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM [U-2H] TRIS, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 150 mM sodium chloride, 1 mM sodium azide, 0.02 ug/mL TSP, 0.5 mM EDTA, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.2) mM | |
10 | EDTA | natural abundance | 0.5 (±0.2) mM | |
11 | TRIS | [U-2H] | 10 (±0.2) mM | |
12 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
13 | sodium azide | natural abundance | 1 (±0.2) mM | |
14 | sodium chloride | natural abundance | 150 (±0.2) mM | |
15 | D2O | natural abundance | 100 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM [U-2H] TRIS, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 150 mM sodium chloride, 1 mM sodium azide, 0.02 ug/mL TSP, 0.5 mM EDTA, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.2) mM | |
10 | EDTA | natural abundance | 0.5 (±0.2) mM | |
11 | TRIS | [U-2H] | 10 (±0.2) mM | |
12 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
13 | sodium azide | natural abundance | 1 (±0.2) mM | |
14 | sodium chloride | natural abundance | 150 (±0.2) mM | |
15 | D2O | natural abundance | 100 mM |
Bruker AvanceIII - 950 MHz at MRC Crick
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 950 MHz at MRC Crick
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM [U-2H] TRIS, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 150 mM sodium chloride, 1 mM sodium azide, 0.02 ug/mL TSP, 0.5 mM EDTA, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.2) mM | |
10 | EDTA | natural abundance | 0.5 (±0.2) mM | |
11 | TRIS | [U-2H] | 10 (±0.2) mM | |
12 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
13 | sodium azide | natural abundance | 1 (±0.2) mM | |
14 | sodium chloride | natural abundance | 150 (±0.2) mM | |
15 | D2O | natural abundance | 100 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.02) mM | |
2 | EDTA | natural abundance | 0.5 (±0.02) mM | |
3 | TRIS | natural abundance | 10 (±0.2) mM | |
4 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
5 | sodium azide | natural abundance | 1 (±0.02) mM | |
6 | sodium chloride | natural abundance | 150 (±0.2) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM [U-2H] TRIS, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 150 mM sodium chloride, 1 mM sodium azide, 0.02 ug/mL TSP, 0.5 mM EDTA, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.2) mM | |
10 | EDTA | natural abundance | 0.5 (±0.2) mM | |
11 | TRIS | [U-2H] | 10 (±0.2) mM | |
12 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
13 | sodium azide | natural abundance | 1 (±0.2) mM | |
14 | sodium chloride | natural abundance | 150 (±0.2) mM | |
15 | D2O | natural abundance | 100 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 bar, Temperature 298 K, pH 6.5, Details 10 mM [U-2H] TRIS, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 150 mM sodium chloride, 1 mM sodium azide, 0.02 ug/mL TSP, 0.5 mM EDTA, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | 15th Fibronectin III domain from human fibronectin | [U-13C; U-15N] | 0.35 (±0.2) mM | |
10 | EDTA | natural abundance | 0.5 (±0.2) mM | |
11 | TRIS | [U-2H] | 10 (±0.2) mM | |
12 | TSP | natural abundance | 0.00002 (±2.0E-7) mg/mL | |
13 | sodium azide | natural abundance | 1 (±0.2) mM | |
14 | sodium chloride | natural abundance | 150 (±0.2) mM | |
15 | D2O | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34048_5m0a.nef |
Input source #2: Coordindates | 5m0a.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---400-------410-------420-------430-------440-------450-------460-------470-------480 NASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNS --------10--------20--------30--------40--------50--------60--------70--------80------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 86 | 0 | 0 | 100.0 |
Content subtype: combined_34048_5m0a.nef
Assigned chemical shifts
---400-------410-------420-------430-------440-------450-------460-------470-------480 NASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
416 | THR | HG1 | 4.89 |
419 | TYR | HH | 10.8 |
422 | SER | HG | 5.42 |
440 | THR | HG1 | 4.92 |
454 | THR | HG1 | 5.08 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 485 | 474 | 97.7 |
13C chemical shifts | 370 | 280 | 75.7 |
15N chemical shifts | 96 | 90 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 174 | 173 | 99.4 |
13C chemical shifts | 172 | 86 | 50.0 |
15N chemical shifts | 82 | 82 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 311 | 301 | 96.8 |
13C chemical shifts | 198 | 194 | 98.0 |
15N chemical shifts | 14 | 8 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 52 | 100.0 |
13C chemical shifts | 52 | 52 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 26 | 92.9 |
13C chemical shifts | 27 | 23 | 85.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---400-------410-------420-------430-------440-------450-------460-------470-------480 NASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNS
Dihedral angle restraints
---400-------410-------420-------430-------440-------450-------460-------470-------480 NASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVG ---400-------410-------420-------430-------440-------450-------460-------470--------