NMR spatial structure of alpha-mammal toxin BeM9
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.8 % (600 of 743) | 97.2 % (377 of 388) | 54.0 % (154 of 285) | 98.6 % (69 of 70) |
Backbone | 68.4 % (264 of 386) | 96.2 % (128 of 133) | 39.6 % (76 of 192) | 98.4 % (60 of 61) |
Sidechain | 94.5 % (394 of 417) | 97.6 % (249 of 255) | 88.9 % (136 of 153) | 100.0 % (9 of 9) |
Aromatic | 80.9 % (55 of 68) | 100.0 % (34 of 34) | 60.6 % (20 of 33) | 100.0 % (1 of 1) |
Methyl | 96.2 % (50 of 52) | 96.2 % (25 of 26) | 96.2 % (25 of 26) |
1. entity 1
ARDAYIAKPH NCVYECYNPK GSYCNDLCTE NGAESGYCQI LGKYGNACWC IQLPDNVPIR IPGKCHSolvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 303 K, pH 3.5, Details 1 mM [U-99% 15N] Alpha-mammal toxin BeM9, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alpha-mammal toxin BeM9 | [U-99% 15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34078_5mou.nef |
Input source #2: Coordindates | 5mou.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:12:CYS:SG | A:65:CYS:SG | oxidized, CB 45.161 ppm | oxidized, CB 38.533 ppm | 2.016 |
A:16:CYS:SG | A:38:CYS:SG | oxidized, CB 46.831 ppm | oxidized, CB 39.199 ppm | 2.044 |
A:24:CYS:SG | A:48:CYS:SG | oxidized, CB 38.548 ppm | oxidized, CB 38.944 ppm | 2.093 |
A:28:CYS:SG | A:50:CYS:SG | oxidized, CB 35.782 ppm | oxidized, CB 38.558 ppm | 2.103 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60------ ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 66 | 0 | 0 | 100.0 |
Content subtype: combined_34078_5mou.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60------ ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
29 | THR | HG1 | 4.756 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 388 | 386 | 99.5 |
13C chemical shifts | 285 | 151 | 53.0 |
15N chemical shifts | 72 | 71 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 133 | 132 | 99.2 |
13C chemical shifts | 132 | 13 | 9.8 |
15N chemical shifts | 61 | 60 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 255 | 254 | 99.6 |
13C chemical shifts | 153 | 138 | 90.2 |
15N chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 26 | 100.0 |
13C chemical shifts | 26 | 26 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 34 | 100.0 |
13C chemical shifts | 33 | 20 | 60.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60------ ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60------ ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ARDAYIAKPHNCVYECYNPKGSYCNDLCTENGAESGYCQILGKYGNACWCIQLPDNVPIRIPGKCH