Bamb_5917 Acyl-Carrier Protein
GIDPFTGAAA GVSAAGIEPD LTAIWQALFA LPAVGRHQDF FALGGDSQLG LRMLAQLRER HGVDLPLRCL YEAPTVARLA ETIVRLAAPA PSGDQDDASE YEEGVIR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.4 % (981 of 1162) | 82.7 % (492 of 595) | 85.0 % (392 of 461) | 91.5 % (97 of 106) |
Backbone | 92.0 % (578 of 628) | 90.8 % (198 of 218) | 92.3 % (286 of 310) | 94.0 % (94 of 100) |
Sidechain | 77.9 % (491 of 630) | 78.0 % (294 of 377) | 78.5 % (194 of 247) | 50.0 % (3 of 6) |
Aromatic | 2.6 % (2 of 76) | 2.6 % (1 of 38) | 0.0 % (0 of 37) | 100.0 % (1 of 1) |
Methyl | 92.9 % (130 of 140) | 91.4 % (64 of 70) | 94.3 % (66 of 70) |
1. Phosphopantetheine-binding protein
GIDPFTGAAA GVSAAGIEPD LTAIWQALFA LPAVGRHQDF FALGGDSQLG LRMLAQLRER HGVDLPLRCL YEAPTVARLA ETIVRLAAPA PSGDQDDASE YEEGVIRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.5 mM [U-99% 15N] 15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N_PCP17 | [U-99% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 1 % | |
4 | H2O | natural abundance | 90 % | |
5 | potassium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 200 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.5 mM [U-99% 15N] 15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N_PCP17 | [U-99% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 1 % | |
4 | H2O | natural abundance | 90 % | |
5 | potassium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.5 mM [U-99% 15N] 15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N_PCP17 | [U-99% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 1 % | |
4 | H2O | natural abundance | 90 % | |
5 | potassium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.5 mM [U-99% 15N] 15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N_PCP17 | [U-99% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 1 % | |
4 | H2O | natural abundance | 90 % | |
5 | potassium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker AvanceII - 700 MHz cryo probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.50 (±0.05), Details 0.3 mM [U-13C; U-15N] 13C,15N_PCP17, 50 mM potassium phosphate, 200 mM sodium chloride, 1 % DSS, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | 13C,15N_PCP17 | [U-13C; U-15N] | 0.3 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 1 % | |
10 | H2O | natural abundance | 90 % | |
11 | potassium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 200 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34085_5mti.nef |
Input source #2: Coordindates | 5mti.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- GIDPFTGAAAGVSAAGIEPDLTAIWQALFALPAVGRHQDFFALGGDSQLGLRMLAQLRERHGVDLPLRCLYEAPTVARLAETIVRLAAPAPSGDQDDASE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDPFTGAAAGVSAAGIEPDLTAIWQALFALPAVGRHQDFFALGGDSQLGLRMLAQLRERHGVDLPLRCLYEAPTVARLAETIVRLAAPAPSGDQDDASE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---100- YEEGVIR ||||||| YEEGVIR -------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 107 | 0 | 0 | 100.0 |
Content subtype: combined_34085_5mti.nef
Assigned chemical shifts
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- GIDPFTGAAAGVSAAGIEPDLTAIWQALFALPAVGRHQDFFALGGDSQLGLRMLAQLRERHGVDLPLRCLYEAPTVARLAETIVRLAAPAPSGDQDDASE | ||||||||||||||||| ||||||||||||||| |||||| ||||||||||||||||||||||||||||||||||||||||||||||| ......G..AGVSAAGIEPDLTAIWQ.LFALPAVGRHQDFFA..GDSQLG...LAQLRERHGVDLPLRCLYEAPTVARLAETIVRLAAPAPSGDQDDASE ---100- YEEGVIR ||||||| YEEGVIR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 595 | 473 | 79.5 |
13C chemical shifts | 461 | 368 | 79.8 |
15N chemical shifts | 114 | 89 | 78.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 218 | 188 | 86.2 |
13C chemical shifts | 214 | 186 | 86.9 |
15N chemical shifts | 100 | 86 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 285 | 75.6 |
13C chemical shifts | 247 | 182 | 73.7 |
15N chemical shifts | 14 | 3 | 21.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 60 | 84.5 |
13C chemical shifts | 71 | 60 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 1 | 2.6 |
13C chemical shifts | 37 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- GIDPFTGAAAGVSAAGIEPDLTAIWQALFALPAVGRHQDFFALGGDSQLGLRMLAQLRERHGVDLPLRCLYEAPTVARLAETIVRLAAPAPSGDQDDASE ||||||||||| |||||||||||| |||||||||||||||||||| |||||||||||||||||||||||||||||||||| |||||||||||| .......AAAGVSAAGIE.DLTAIWQALFAL.AVGRHQDFFALGGDSQLGLR.LAQLRERHGVDLPLRCLYEAPTVARLAETIVRLA.PAPSGDQDDASE ---100- YEEGVIR ||||||| YEEGVIR
Dihedral angle restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- GIDPFTGAAAGVSAAGIEPDLTAIWQALFALPAVGRHQDFFALGGDSQLGLRMLAQLRERHGVDLPLRCLYEAPTVARLAETIVRLAAPAPSGDQDDASE ||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||||||||||||| ..................PDLTAIWQALFAL.AVG..QDFFALGGDSQLGLRMLAQLRERHGVDLPLRCLYEAPTVARLAETIVRLA --------------10--------20--------30--------40--------50--------60--------70--------80- ---100- YEEGVIR