Sigma1.1 domain of sigmaA from Bacillus subtilis
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.2 % (833 of 884) | 94.4 % (435 of 461) | 93.8 % (320 of 341) | 95.1 % (78 of 82) |
Backbone | 94.5 % (431 of 456) | 94.2 % (147 of 156) | 94.6 % (212 of 224) | 94.7 % (72 of 76) |
Sidechain | 94.0 % (470 of 500) | 94.4 % (288 of 305) | 93.1 % (176 of 189) | 100.0 % (6 of 6) |
Aromatic | 77.1 % (54 of 70) | 77.1 % (27 of 35) | 77.1 % (27 of 35) | |
Methyl | 96.9 % (62 of 64) | 96.9 % (31 of 32) | 96.9 % (31 of 32) |
1. entity 1
ADKQTHETEL TFDQVKEQLT ESGKKRGVLT YEEIAERMSS FEIESDQMDE YYEFLGEQGV ELISENEETE DLEHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.6 mM [U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sigma1.1 | [U-15N] | 0.6 mM | |
2 | sodium azide | natural abundance | 6 mM | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 5 % NA- polyacrylamide gel, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | polyacrylamide gel | natural abundance | 5 % | |
10 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
11 | sodium azide | natural abundance | 6 mM | |
12 | sodium chloride | natural abundance | 10 mM | |
13 | sodium phosphate | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.6 mM [U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sigma1.1 | [U-15N] | 0.6 mM | |
2 | sodium azide | natural abundance | 6 mM | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 5 % NA- polyacrylamide gel, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | polyacrylamide gel | natural abundance | 5 % | |
10 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
11 | sodium azide | natural abundance | 6 mM | |
12 | sodium chloride | natural abundance | 10 mM | |
13 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
6 | sodium azide | natural abundance | 6 mM | |
7 | sodium chloride | natural abundance | 10 mM | |
8 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 5 % NA- polyacrylamide gel, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | polyacrylamide gel | natural abundance | 5 % | |
10 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
11 | sodium azide | natural abundance | 6 mM | |
12 | sodium chloride | natural abundance | 10 mM | |
13 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 850 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.6, Details 0.8 mM [U-13C; U-15N] sigma1.1, 10 mM NA- sodium chloride, 20 mM NA- sodium phosphate, 6 mM NA- sodium azide, 5 % NA- polyacrylamide gel, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | polyacrylamide gel | natural abundance | 5 % | |
10 | sigma1.1 | [U-13C; U-15N] | 0.8 mM | |
11 | sodium azide | natural abundance | 6 mM | |
12 | sodium chloride | natural abundance | 10 mM | |
13 | sodium phosphate | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_34089_5mww.nef |
Input source #2: Coordindates | 5mww.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------ ADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQGVELISENEETEDLEHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQGVELISENEETEDLEHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 76 | 0 | 0 | 100.0 |
Content subtype: combined_34089_5mww.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------ ADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQGVELISENEETEDLEHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .DKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQGVELISENEETEDLE --------10--------20--------30--------40--------50--------60--------70---
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
4 | GLN | CD | 180.382 |
14 | GLN | CD | 179.858 |
18 | GLN | CD | 179.69 |
20 | THR | HG1 | 5.898 |
26 | ARG | CZ | 179.887 |
37 | ARG | CZ | 179.92 |
47 | GLN | CD | 179.594 |
58 | GLN | CD | 179.369 |
66 | ASN | CG | 176.853 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 461 | 437 | 94.8 |
13C chemical shifts | 341 | 321 | 94.1 |
15N chemical shifts | 84 | 79 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 156 | 147 | 94.2 |
13C chemical shifts | 152 | 144 | 94.7 |
15N chemical shifts | 76 | 71 | 93.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 305 | 290 | 95.1 |
13C chemical shifts | 189 | 177 | 93.7 |
15N chemical shifts | 8 | 8 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 33 | 97.1 |
13C chemical shifts | 34 | 33 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 27 | 77.1 |
13C chemical shifts | 35 | 27 | 77.1 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------ ADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQGVELISENEETEDLEHHH ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KQT.ETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQGVELISENEETEDLE --------10--------20--------30--------40--------50--------60--------70---