Solution structure of the Dbl-homology domain of Bcr-Abl
AMASELDLEK GLEMRKWVLS GILASEETYL SHLEALLLPM KPLKAAATTS QPVLTSQQIE TIFFKVPELY EIHKEFYDGL FPRVQQWSHQ QRVGDLFQKL ASQLGVYRAF VDNYGVAMEM AEKCCQANAQ FAEISENLRA RSNKDAKDPT TKNSLETLLY KPVDRVTRST LVLHDLLKHT PASHPDHPLL QDALRISQNF LSSINEEITP RRQSMTVK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.9 % (2544 of 2598) | 97.6 % (1322 of 1355) | 99.6 % (1009 of 1013) | 92.6 % (213 of 230) |
Backbone | 99.0 % (1273 of 1286) | 97.2 % (419 of 431) | 99.8 % (647 of 648) | 100.0 % (207 of 207) |
Sidechain | 97.3 % (1483 of 1524) | 97.7 % (903 of 924) | 99.5 % (574 of 577) | 26.1 % (6 of 23) |
Aromatic | 99.4 % (179 of 180) | 98.9 % (89 of 90) | 100.0 % (88 of 88) | 100.0 % (2 of 2) |
Methyl | 99.6 % (257 of 258) | 99.2 % (128 of 129) | 100.0 % (129 of 129) |
1. entity 1
AMASELDLEK GLEMRKWVLS GILASEETYL SHLEALLLPM KPLKAAATTS QPVLTSQQIE TIFFKVPELY EIHKEFYDGL FPRVQQWSHQ QRVGDLFQKL ASQLGVYRAF VDNYGVAMEM AEKCCQANAQ FAEISENLRA RSNKDAKDPT TKNSLETLLY KPVDRVTRST LVLHDLLKHT PASHPDHPLL QDALRISQNF LSSINEEITP RRQSMTVKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 900 Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 950 Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 950 Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 800 Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker 600 Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0, Details 0.85 mM [U-13C; U-15N] DH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DH | [U-13C; U-15N] | 0.85 mM | |
2 | Hepes | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34101_5n6r.nef |
Input source #2: Coordindates | 5n6r.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---490-------500-------510-------520-------530-------540-------550-------560-------570-------580---- AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---590-------600-------610-------620-------630-------640-------650-------660-------670-------680---- ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 ---690-------700-- LSSINEEITPRRQSMTVK |||||||||||||||||| LSSINEEITPRRQSMTVK -------210--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 218 | 0 | 0 | 100.0 |
Content subtype: combined_34101_5n6r.nef
Assigned chemical shifts
---490-------500-------510-------520-------530-------540-------550-------560-------570-------580---- AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL ---590-------600-------610-------620-------630-------640-------650-------660-------670-------680---- ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF ---690-------700-- LSSINEEITPRRQSMTVK |||||||||||||||||| LSSINEEITPRRQSMTVK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
488 | SER | HG | 4.731 |
504 | SER | HG | 4.268 |
509 | SER | HG | 7.623 |
512 | THR | HG1 | 4.351 |
513 | TYR | HH | 9.166 |
515 | SER | HG | 8.194 |
516 | HIS | HD1 | 6.98 |
532 | THR | HG1 | 4.195 |
533 | THR | HG1 | 5.584 |
534 | SER | HG | 4.275 |
539 | THR | HG1 | 7.658 |
540 | SER | HG | 4.728 |
545 | THR | HG1 | 3.905 |
554 | TYR | HH | 8.869 |
557 | HIS | HD1 | 7.7 |
561 | TYR | HH | 8.584 |
572 | SER | HG | 3.978 |
573 | HIS | HD1 | 8.006 |
586 | SER | HG | 4.711 |
591 | TYR | HH | 7.62 |
608 | CYS | HG | 1.504 |
609 | CYS | HG | 1.683 |
619 | SER | HG | 4.109 |
626 | SER | HG | 4.733 |
634 | THR | HG1 | 4.732 |
635 | THR | HG1 | 4.732 |
638 | SER | HG | 4.732 |
641 | THR | HG1 | 4.728 |
651 | THR | HG1 | 0.978 |
653 | SER | HG | 5.466 |
654 | THR | HG1 | 0.736 |
658 | HIS | HD1 | 8.13 |
663 | HIS | HD1 | 6.913 |
664 | THR | HG1 | 4.728 |
667 | SER | HG | 4.736 |
668 | HIS | HD1 | 8.265 |
671 | HIS | HD1 | 6.616 |
681 | SER | HG | 4.52 |
686 | SER | HG | 7.24 |
687 | SER | HG | 7.878 |
693 | THR | HG1 | 7.65 |
698 | SER | HG | 4.729 |
700 | THR | HG1 | 4.732 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1355 | 1342 | 99.0 |
13C chemical shifts | 1013 | 1008 | 99.5 |
15N chemical shifts | 241 | 210 | 87.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 431 | 430 | 99.8 |
13C chemical shifts | 436 | 435 | 99.8 |
15N chemical shifts | 207 | 207 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 924 | 912 | 98.7 |
13C chemical shifts | 577 | 573 | 99.3 |
15N chemical shifts | 34 | 3 | 8.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 135 | 135 | 100.0 |
13C chemical shifts | 135 | 135 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 90 | 89 | 98.9 |
13C chemical shifts | 88 | 88 | 100.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
---490-------500-------510-------520-------530-------540-------550-------560-------570-------580---- AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL ---590-------600-------610-------620-------630-------640-------650-------660-------670-------680---- ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF ---690-------700-- LSSINEEITPRRQSMTVK |||||||||||||||||| LSSINEEITPRRQSMTVK
Dihedral angle restraints
---490-------500-------510-------520-------530-------540-------550-------560-------570-------580---- AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| ...SELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFK.PELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKL ---490-------500-------510-------520-------530-------540-------550-------560-------570-------580---- ---590-------600-------610-------620-------630-------640-------650-------660-------670-------680---- ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF ||||||||||||||||||||||||||||||||||||||| |||||| |||||||||||||||||||||||||||||||||||||||||||||||||| ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLR....KDAKDP.TKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF ---590-------600-------610-------620-------630-------640-------650-------660-------670-------680---- ---690-------700-- LSSINEEITPRRQSMTVK ||||||||| LSSINEEIT ---690---