Solution structure of B. subtilis Sigma G inhibitor CsfB
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.8 % (485 of 559) | 92.4 % (267 of 289) | 78.1 % (171 of 219) | 92.2 % (47 of 51) |
Backbone | 81.2 % (237 of 292) | 94.9 % (93 of 98) | 68.5 % (100 of 146) | 91.7 % (44 of 48) |
Sidechain | 93.7 % (295 of 315) | 91.1 % (174 of 191) | 97.5 % (118 of 121) | 100.0 % (3 of 3) |
Aromatic | 88.2 % (30 of 34) | 88.2 % (15 of 17) | 88.2 % (15 of 17) | |
Methyl | 100.0 % (52 of 52) | 100.0 % (26 of 26) | 100.0 % (26 of 26) |
1. entity 1
SMDETVKLNH TCVICDQEKN RGIHLYTKFI CLDCERKVIS TSTSDPDYASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 uM [U-100% 13C; U-100% 15N] CsfB, 0.5 uM CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | CsfB | natural abundance | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 uM [U-100% 13C; U-100% 15N] CsfB, 0.5 uM CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | CsfB | natural abundance | 0.5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1 mM [U-100% 13C; U-100% 15N] CsfB, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsfB-labelled | [U-100% 13C; U-100% 15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34102_5n7y.nef |
Input source #2: Coordindates | 5n7y.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:12:CYS:SG | 3:1:ZN:ZN | unknown | unknown | n/a |
1:15:CYS:SG | 3:1:ZN:ZN | unknown | unknown | n/a |
1:31:CYS:SG | 3:1:ZN:ZN | unknown | unknown | n/a |
1:34:CYS:SG | 3:1:ZN:ZN | unknown | unknown | n/a |
2:12:CYS:SG | 3:2:ZN:ZN | unknown | unknown | n/a |
2:15:CYS:SG | 3:2:ZN:ZN | unknown | unknown | n/a |
2:31:CYS:SG | 3:2:ZN:ZN | unknown | unknown | n/a |
2:34:CYS:SG | 3:2:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
Sequence alignments
0--------10--------20--------30--------40-------- SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA ||||||||||||||||||||||||||||||||||||||||||||||||| SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA --------10--------20--------30--------40---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 49 | 0 | 0 | 100.0 |
C | C | 49 | 0 | 0 | 100.0 |
Content subtype: combined_34102_5n7y.nef
Assigned chemical shifts
0--------10--------20--------30--------40-------- SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA |||||||||||||||||||||||||||||||||||||||||||||||| .MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 289 | 267 | 92.4 |
13C chemical shifts | 219 | 166 | 75.8 |
15N chemical shifts | 53 | 47 | 88.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 98 | 93 | 94.9 |
13C chemical shifts | 98 | 48 | 49.0 |
15N chemical shifts | 48 | 44 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 191 | 174 | 91.1 |
13C chemical shifts | 121 | 118 | 97.5 |
15N chemical shifts | 5 | 3 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 27 | 100.0 |
13C chemical shifts | 27 | 27 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 15 | 88.2 |
13C chemical shifts | 17 | 15 | 88.2 |
Covalent bonds
Distance restraints
0--------10--------20--------30--------40-------- SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA |||||||||||||||||||||||||||||||||||||||||||||||| .MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA
0--------10--------20--------30--------40-------- SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA |||||||||||||||||||||||||||||||||||||||||||||||| .MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA
Dihedral angle restraints
0--------10--------20--------30--------40-------- SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA ||||||||||||||||||||||||||||||||||||| .......LNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTS 0--------10--------20--------30--------40---