LysF1 sh3b domain structure
ETPATRPVTG SWKKNQYGTW YKPENATFVN GNQPIVTRIG SPFLNAPVGG NLPAGATIVY DEVCIQAGHI WIGYNAYNGN RVYCPVRTCQ GVPPNQIPGV AWGVFK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.2 % (1145 of 1216) | 93.6 % (589 of 629) | 93.9 % (444 of 473) | 98.2 % (112 of 114) |
Backbone | 97.9 % (601 of 614) | 97.7 % (209 of 214) | 98.0 % (299 of 305) | 97.9 % (93 of 95) |
Sidechain | 91.5 % (636 of 695) | 91.6 % (380 of 415) | 90.8 % (237 of 261) | 100.0 % (19 of 19) |
Aromatic | 70.8 % (92 of 130) | 70.8 % (46 of 65) | 68.9 % (42 of 61) | 100.0 % (4 of 4) |
Methyl | 100.0 % (112 of 112) | 100.0 % (56 of 56) | 100.0 % (56 of 56) |
1. entity 1
ETPATRPVTG SWKKNQYGTW YKPENATFVN GNQPIVTRIG SPFLNAPVGG NLPAGATIVY DEVCIQAGHI WIGYNAYNGN RVYCPVRTCQ GVPPNQIPGV AWGVFKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20 mM Na-phosphate, 0.25 mM [U-99% 13C; U-99% 15N] sh3b domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Na-phosphate | natural abundance | 20 mM | |
2 | sh3b domain | [U-99% 13C; U-99% 15N] | 0.25 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34139_5o1q.nef |
Input source #2: Coordindates | 5o1q.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ETPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ETPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGV ------ AWGVFK |||||| AWGVFK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_34139_5o1q.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ETPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ETPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGV.PNQIPGV ------ AWGVFK |||||| AWGVFK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 629 | 583 | 92.7 |
13C chemical shifts | 473 | 439 | 92.8 |
15N chemical shifts | 118 | 111 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 208 | 97.2 |
13C chemical shifts | 212 | 207 | 97.6 |
15N chemical shifts | 95 | 92 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 415 | 375 | 90.4 |
13C chemical shifts | 261 | 232 | 88.9 |
15N chemical shifts | 23 | 19 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 56 | 100.0 |
13C chemical shifts | 56 | 56 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 41 | 63.1 |
13C chemical shifts | 61 | 37 | 60.7 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ETPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGV || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TP.TRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGV ------ AWGVFK |||||| AWGVFK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ETPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........SWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGV ------ AWGVFK |||||| AWGVFK