NMR spatial structure of HER2 TM domain dimer in DPC micelles
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.0 % (502 of 523) | 95.2 % (259 of 272) | 98.1 % (202 of 206) | 91.1 % (41 of 45) |
Backbone | 98.8 % (257 of 260) | 98.9 % (89 of 90) | 99.2 % (127 of 128) | 97.6 % (41 of 42) |
Sidechain | 93.7 % (284 of 303) | 93.4 % (170 of 182) | 96.6 % (114 of 118) | 0.0 % (0 of 3) |
Aromatic | 80.0 % (8 of 10) | 100.0 % (5 of 5) | 60.0 % (3 of 5) | |
Methyl | 100.0 % (80 of 80) | 100.0 % (40 of 40) | 100.0 % (40 of 40) |
1. entity 1
GCPAEQRASP LTSIISAVVG ILLVVVLGVV FGILIKRRQQ KIRKSolvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 313 K, pH 6.0 (±0.1), Details 2.5 mM [U-100% 13C; U-100% 15N] HER2TM, 2.5 mM HER2TM, 200 mM [U-99% 2H] DPC, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DPC | [U-99% 2H] | 200 mM | |
2 | HER2TM | natural abundance | 2.5 mM | |
3 | HER2TM_label | [U-100% 13C; U-100% 15N] | 2.5 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 0.01 % |
Bruker av600 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 313 K, pH 6.0 (±0.1), Details 2.5 mM [U-100% 13C; U-100% 15N] HER2TM, 2.5 mM HER2TM, 200 mM [U-99% 2H] DPC, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DPC | [U-99% 2H] | 200 mM | |
2 | HER2TM | natural abundance | 2.5 mM | |
3 | HER2TM_label | [U-100% 13C; U-100% 15N] | 2.5 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 0.01 % |
Bruker av600 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 313 K, pH 6.0 (±0.1), Details 2.5 mM [U-100% 13C; U-100% 15N] HER2TM, 2.5 mM HER2TM, 200 mM [U-99% 2H] DPC, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DPC | [U-99% 2H] | 200 mM | |
2 | HER2TM | natural abundance | 2.5 mM | |
3 | HER2TM_label | [U-100% 13C; U-100% 15N] | 2.5 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 0.01 % |
Bruker av600 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 313 K, pH 6.0 (±0.1), Details 2.5 mM [U-100% 13C; U-100% 15N] HER2TM, 2.5 mM HER2TM, 200 mM [U-99% 2H] DPC, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DPC | [U-99% 2H] | 200 mM | |
2 | HER2TM | natural abundance | 2.5 mM | |
3 | HER2TM_label | [U-100% 13C; U-100% 15N] | 2.5 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 0.01 % |
Bruker av600 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 313 K, pH 6.0 (±0.1), Details 2.5 mM [U-100% 13C; U-100% 15N] HER2TM, 2.5 mM HER2TM, 200 mM [U-99% 2H] DPC, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DPC | [U-99% 2H] | 200 mM | |
2 | HER2TM | natural abundance | 2.5 mM | |
3 | HER2TM_label | [U-100% 13C; U-100% 15N] | 2.5 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 0.01 % |
Bruker av600 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 313 K, pH 6.0 (±0.1), Details 2.5 mM [U-100% 13C; U-100% 15N] HER2TM, 2.5 mM HER2TM, 200 mM [U-99% 2H] DPC, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DPC | [U-99% 2H] | 200 mM | |
2 | HER2TM | natural abundance | 2.5 mM | |
3 | HER2TM_label | [U-100% 13C; U-100% 15N] | 2.5 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 0.01 % |
Bruker av600 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 313 K, pH 6.0 (±0.1), Details 2.5 mM [U-100% 13C; U-100% 15N] HER2TM, 2.5 mM HER2TM, 200 mM [U-99% 2H] DPC, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DPC | [U-99% 2H] | 200 mM | |
2 | HER2TM | natural abundance | 2.5 mM | |
3 | HER2TM_label | [U-100% 13C; U-100% 15N] | 2.5 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 0.01 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34154_5ob4.nef |
Input source #2: Coordindates | 5ob4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40---- GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK |||||||||||||||||||||||||||||||||||||||||||| GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
-------110-------120-------130-------140---- GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK |||||||||||||||||||||||||||||||||||||||||||| GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK --------10--------20--------30--------40----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 44 | 0 | 0 | 100.0 |
B | B | 44 | 0 | 0 | 100.0 |
Content subtype: combined_34154_5ob4.nef
Assigned chemical shifts
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
3 | PRO | N | 138.718 |
10 | PRO | N | 137.92 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 272 | 259 | 95.2 |
13C chemical shifts | 206 | 202 | 98.1 |
15N chemical shifts | 49 | 45 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 90 | 89 | 98.9 |
13C chemical shifts | 88 | 88 | 100.0 |
15N chemical shifts | 42 | 41 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 182 | 170 | 93.4 |
13C chemical shifts | 118 | 114 | 96.6 |
15N chemical shifts | 7 | 4 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 40 | 100.0 |
13C chemical shifts | 40 | 40 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 5 | 5 | 100.0 |
13C chemical shifts | 5 | 3 | 60.0 |
Distance restraints
--------10--------20--------30--------40---- GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK |||||||||||||||||||||||||||||||||||||||||||| GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
-------110-------120-------130-------140---- GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK |||||||||||||||||||||||||||||||||||||||||||| GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Dihedral angle restraints
--------10--------20--------30--------40---- GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK ||||||||||||||||||||||||||||||||||||||||||| .CPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
-------110-------120-------130-------140---- GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK ||||||||||||||||||||||||||||||||||||||||||| .CPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK