4th KOW domain of human hSpt5
AMGSETASGV DVGGQHEWGE LVQLDPQTVG VIVRLERETF QVLNMYGKVV TVRHQAVTRK KDNRFAVALD SEQNNIHVKD IVKVIDGPHS GREGEIRHLF RSFAFLHCKK LVENGGMFVC KTRHLVLAG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.4 % (1334 of 1493) | 88.2 % (682 of 773) | 90.4 % (525 of 581) | 91.4 % (127 of 139) |
Backbone | 94.3 % (726 of 770) | 93.7 % (252 of 269) | 94.1 % (352 of 374) | 96.1 % (122 of 127) |
Sidechain | 85.8 % (720 of 839) | 85.3 % (430 of 504) | 88.2 % (285 of 323) | 41.7 % (5 of 12) |
Aromatic | 73.1 % (79 of 108) | 77.8 % (42 of 54) | 67.9 % (36 of 53) | 100.0 % (1 of 1) |
Methyl | 98.7 % (156 of 158) | 98.7 % (78 of 79) | 98.7 % (78 of 79) |
1. entity 1
AMGSETASGV DVGGQHEWGE LVQLDPQTVG VIVRLERETF QVLNMYGKVV TVRHQAVTRK KDNRFAVALD SEQNNIHVKD IVKVIDGPHS GREGEIRHLF RSFAFLHCKK LVENGGMFVC KTRHLVLAGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 700 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - na MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.6 mM [U-99% 13C; U-99% 15N] KOW4, 20 mM sodium phosphate, 20 mM sodium chloride, 0.5 mM DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KOW4 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | DTT | natural abundance | 0.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34184_6eqy.nef |
Input source #2: Coordindates | 6eqy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- AMGSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AMGSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLF --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------110-------120-------130 RSFAFLHCKKLVENGGMFVCKTRHLVLAG ||||||||||||||||||||||||||||| RSFAFLHCKKLVENGGMFVCKTRHLVLAG -------110-------120---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 129 | 0 | 0 | 100.0 |
Content subtype: combined_34184_6eqy.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- AMGSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| .MGSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRK.DNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLF ------110-------120-------130 RSFAFLHCKKLVENGGMFVCKTRHLVLAG ||||||||||||||||||||||||||||| RSFAFLHCKKLVENGGMFVCKTRHLVLAG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 773 | 682 | 88.2 |
13C chemical shifts | 581 | 522 | 89.8 |
15N chemical shifts | 148 | 126 | 85.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 269 | 255 | 94.8 |
13C chemical shifts | 258 | 240 | 93.0 |
15N chemical shifts | 127 | 121 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 504 | 427 | 84.7 |
13C chemical shifts | 323 | 282 | 87.3 |
15N chemical shifts | 21 | 5 | 23.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 81 | 98.8 |
13C chemical shifts | 82 | 81 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 41 | 75.9 |
13C chemical shifts | 53 | 34 | 64.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- AMGSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLF |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| ..............QHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRK....FAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLF ------110-------120-------130 RSFAFLHCKKLVENGGMFVCKTRHLVLAG ||||||||||||||||||||||||||||| RSFAFLHCKKLVENGGMFVCKTRHLVLAG
Dihedral angle restraints
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- AMGSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLF ||||||||| ||||| ||||||||||||||||||||||||||| |||||||||||| |||| |||||||||||||||||||| ...............HEWGELVQL...TVGVI..LERETFQVLNMYGKVVTVRHQAVTRKK.NRFAVALDSEQN.IHVK.IVKVIDGPHSGREGEIRHLF -------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- ------110-------120-------130 RSFAFLHCKKLVENGGMFVCKTRHLVLAG | ||||||| ||| |||||||||||| R.FAFLHCK..VEN..MFVCKTRHLVLA ------110-------120---------