Solution Structure of Rhabdopeptide NRPS Docking Domain Kj12C-NDD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.3 % (725 of 761) | 95.7 % (381 of 398) | 94.1 % (272 of 289) | 97.3 % (72 of 74) |
Backbone | 95.7 % (360 of 376) | 97.6 % (124 of 127) | 94.1 % (176 of 187) | 96.8 % (60 of 62) |
Sidechain | 95.1 % (424 of 446) | 94.8 % (257 of 271) | 95.1 % (155 of 163) | 100.0 % (12 of 12) |
Aromatic | 81.8 % (36 of 44) | 81.8 % (18 of 22) | 81.0 % (17 of 21) | 100.0 % (1 of 1) |
Methyl | 97.4 % (76 of 78) | 97.4 % (38 of 39) | 97.4 % (38 of 39) |
1. entity 1
GIDAAQIVDE ALEQGITLFV VNNRLQYETS RDSIPTELLN KWKQHKQELI DFLNQLDSEE QTKSolvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 200 uM [U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Kj12CDD | [U-15N] | 200 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 200 uM [U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Kj12CDD | [U-15N] | 200 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 200 uM [U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Kj12CDD | [U-15N] | 200 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 600 MHz Wasserwerk
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 600 MHz Wasserwerk
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-13C; U-15N] Kj12CDD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Kj12CDD | [U-13C; U-15N] | 700 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34195_6ewu.nef |
Input source #2: Coordindates | 6ewu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 63 | 0 | 0 | 100.0 |
Content subtype: combined_34195_6ewu.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 398 | 385 | 96.7 |
13C chemical shifts | 289 | 274 | 94.8 |
15N chemical shifts | 76 | 72 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 127 | 126 | 99.2 |
13C chemical shifts | 126 | 119 | 94.4 |
15N chemical shifts | 62 | 60 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 271 | 259 | 95.6 |
13C chemical shifts | 163 | 155 | 95.1 |
15N chemical shifts | 14 | 12 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 38 | 97.4 |
13C chemical shifts | 39 | 38 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 16 | 72.7 |
13C chemical shifts | 21 | 15 | 71.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDS --------10--------20--------30--------40--------50--------