Solution Structure of Docking Domain Complex of RXP NRPS: Kj12C NDD - Kj12B CDD
GIDAAQIVDE ALEQGITLFV VNNRLQYETS RDSIPTELLN KWKQHKQELI DFLNQLDSEE QTKGSGSGSG SGSGSLLKEK RKHFQAEQNS SQEYLRGEI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.2 % (972 of 1154) | 89.0 % (540 of 607) | 77.6 % (336 of 433) | 84.2 % (96 of 114) |
Backbone | 80.2 % (475 of 592) | 89.8 % (185 of 206) | 69.1 % (199 of 288) | 92.9 % (91 of 98) |
Sidechain | 89.4 % (583 of 652) | 88.5 % (355 of 401) | 94.9 % (223 of 235) | 31.3 % (5 of 16) |
Aromatic | 81.8 % (54 of 66) | 81.8 % (27 of 33) | 81.3 % (26 of 32) | 100.0 % (1 of 1) |
Methyl | 100.0 % (96 of 96) | 100.0 % (48 of 48) | 100.0 % (48 of 48) |
1. entity 1
GIDAAQIVDE ALEQGITLFV VNNRLQYETS RDSIPTELLN KWKQHKQELI DFLNQLDSEE QTKGSGSGSG SGSGSLLKEK RKHFQAEQNS SQEYLRGEISolvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 15N] | 700 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 15N] | 700 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 600 MHz ww
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 700 uM [U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 15N] | 700 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 Pa, Temperature 293 K, pH 6.5, Details 850 uM [U-99% 13C; U-99% 15N] KJ12C Ndd 12xGS KJ12B Cdd, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KJ12C Ndd 12xGS KJ12B Cdd | [U-99% 13C; U-99% 15N] | 850 uM | |
5 | sodium phosphate buffer | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34196_6ewv.nef |
Input source #2: Coordindates | 6ewv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70-------1550------1560-------- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTKGSGSGSGSGSGSLLKEKRKHFQAEQNSSQEYLRGEI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTKGSGSGSGSGSGSLLKEKRKHFQAEQNSSQEYLRGEI --------10--------20--------30--------40--------50--------60--------70--------80--------90---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_34196_6ewv.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-------1550------1560-------- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTKGSGSGSGSGSGSLLKEKRKHFQAEQNSSQEYLRGEI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTKGSGSG................................ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 .................................................................................................... -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 .................................................................................................... -------210-------220-------230-------240-------250-------260-------270-------280-------290-------300 .................................................................................................... -------310-------320-------330-------340-------350-------360-------370-------380-------390-------400 .................................................................................................... -------410-------420-------430-------440-------450-------460-------470-------480-------490-------500 .................................................................................................... -------510-------520-------530-------540-------550-------560-------570-------580-------590-------600 .................................................................................................... -------610-------620-------630-------640-------650-------660-------670-------680-------690-------700 .................................................................................................... -------710-------720-------730-------740-------750-------760-------770-------780-------790-------800 .................................................................................................... -------810-------820-------830-------840-------850-------860-------870-------880-------890-------900 .................................................................................................... -------910-------920-------930-------940-------950-------960-------970-------980-------990------1000 .................................................................................................... ------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100 .................................................................................................... ------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200 .................................................................................................... ------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300 .................................................................................................... ------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400 .................................................................................................... ------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500 ............................................LLKEKRKHFQAEQNSSQEYLRGEI ------1510------1520------1530------1540------1550------1560--------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 607 | 530 | 87.3 |
13C chemical shifts | 433 | 312 | 72.1 |
15N chemical shifts | 118 | 90 | 76.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 206 | 183 | 88.8 |
13C chemical shifts | 198 | 90 | 45.5 |
15N chemical shifts | 98 | 89 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 401 | 347 | 86.5 |
13C chemical shifts | 235 | 222 | 94.5 |
15N chemical shifts | 20 | 1 | 5.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 48 | 100.0 |
13C chemical shifts | 48 | 48 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 27 | 81.8 |
13C chemical shifts | 32 | 26 | 81.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70-------1550------1560-------- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTKGSGSGSGSGSGSLLKEKRKHFQAEQNSSQEYLRGEI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTKGSGSG................................ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 .................................................................................................... -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 .................................................................................................... -------210-------220-------230-------240-------250-------260-------270-------280-------290-------300 .................................................................................................... -------310-------320-------330-------340-------350-------360-------370-------380-------390-------400 .................................................................................................... -------410-------420-------430-------440-------450-------460-------470-------480-------490-------500 .................................................................................................... -------510-------520-------530-------540-------550-------560-------570-------580-------590-------600 .................................................................................................... -------610-------620-------630-------640-------650-------660-------670-------680-------690-------700 .................................................................................................... -------710-------720-------730-------740-------750-------760-------770-------780-------790-------800 .................................................................................................... -------810-------820-------830-------840-------850-------860-------870-------880-------890-------900 .................................................................................................... -------910-------920-------930-------940-------950-------960-------970-------980-------990------1000 .................................................................................................... ------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100 .................................................................................................... ------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200 .................................................................................................... ------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300 .................................................................................................... ------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400 .................................................................................................... ------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500 ............................................LLKEKRKHFQAEQNSSQEYLRGEI ------1510------1520------1530------1540------1550------1560--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70-------1550------1560-------- GIDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQTKGSGSGSGSGSGSLLKEKRKHFQAEQNSSQEYLRGEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | .IDAAQIVDEALEQGITLFVVNNRLQYETSRDSIPTELLNKWKQHKQELIDFLNQLDSEEQ.............S......................... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 .................................................................................................... -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 .................................................................................................... -------210-------220-------230-------240-------250-------260-------270-------280-------290-------300 .................................................................................................... -------310-------320-------330-------340-------350-------360-------370-------380-------390-------400 .................................................................................................... -------410-------420-------430-------440-------450-------460-------470-------480-------490-------500 .................................................................................................... -------510-------520-------530-------540-------550-------560-------570-------580-------590-------600 .................................................................................................... -------610-------620-------630-------640-------650-------660-------670-------680-------690-------700 .................................................................................................... -------710-------720-------730-------740-------750-------760-------770-------780-------790-------800 .................................................................................................... -------810-------820-------830-------840-------850-------860-------870-------880-------890-------900 .................................................................................................... -------910-------920-------930-------940-------950-------960-------970-------980-------990------1000 .................................................................................................... ------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100 .................................................................................................... ------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200 .................................................................................................... ------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300 .................................................................................................... ------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400 .................................................................................................... ------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500 ............................................LLKEKRKHFQA......EYLRGE ------1510------1520------1530------1540------1550------1560-------