PH domain from PfAPH
SAKDIKDEKI QQYRKTLTKI VKIKTAIFHE TVKVTCSKDG KMLEWYKGKN DSDGKKKPIG SFPLNKITSI RTKVDNLKSL EISVSSVHIS TYLFTFKTRE ERESWQNNLE SFRKIMSMK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.6 % (1438 of 1488) | 96.3 % (758 of 787) | 97.2 % (558 of 574) | 96.1 % (122 of 127) |
Backbone | 98.6 % (700 of 710) | 98.3 % (236 of 240) | 98.6 % (348 of 353) | 99.1 % (116 of 117) |
Sidechain | 95.4 % (852 of 893) | 95.4 % (522 of 547) | 96.4 % (324 of 336) | 60.0 % (6 of 10) |
Aromatic | 88.7 % (94 of 106) | 92.5 % (49 of 53) | 84.3 % (43 of 51) | 100.0 % (2 of 2) |
Methyl | 98.3 % (118 of 120) | 96.7 % (58 of 60) | 100.0 % (60 of 60) |
1. entity 1
SAKDIKDEKI QQYRKTLTKI VKIKTAIFHE TVKVTCSKDG KMLEWYKGKN DSDGKKKPIG SFPLNKITSI RTKVDNLKSL EISVSSVHIS TYLFTFKTRE ERESWQNNLE SFRKIMSMKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.78 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | water | protons | 4.78 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.78 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | water | protons | 4.78 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.78 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | water | protons | 4.78 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.78 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | water | protons | 4.78 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 830 uM [U-100% 15N]; [U-100% 13C] C-terminal PH domain from PfAPH, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminal PH domain from PfAPH | [U-100% 15N; U-100% 13C] | 830 uM | |
2 | NaCl | natural abundance | 300 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts | combined_34202_6f24.nef |
Input source #2: Coordindates | 6f24.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------20--------30--------40--------50--------60--------70--------80--------90-------100-------110- SAKDIKDEKIQQYRKTLTKIVKIKTAIFHETVKVTCSKDGKMLEWYKGKNDSDGKKKPIGSFPLNKITSIRTKVDNLKSLEISVSSVHISTYLFTFKTRE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SAKDIKDEKIQQYRKTLTKIVKIKTAIFHETVKVTCSKDGKMLEWYKGKNDSDGKKKPIGSFPLNKITSIRTKVDNLKSLEISVSSVHISTYLFTFKTRE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------120-------130 ERESWQNNLESFRKIMSMK ||||||||||||||||||| ERESWQNNLESFRKIMSMK -------110---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
Content subtype: combined_34202_6f24.nef
# | Content subtype | Saveframe | Status | # of rows | Experiment type | Sequence coverage (%) |
---|---|---|---|---|---|---|
1 | Assigned chemical shifts | assigned_chemical_shifts_1 | Warning | 1442 | 99.2 (chain: A, length: 119) |
Assigned chemical shifts
-------20--------30--------40--------50--------60--------70--------80--------90-------100-------110- SAKDIKDEKIQQYRKTLTKIVKIKTAIFHETVKVTCSKDGKMLEWYKGKNDSDGKKKPIGSFPLNKITSIRTKVDNLKSLEISVSSVHISTYLFTFKTRE |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| SAKDIKDEKIQQYRKTLTKIVKIKTAIFHETVKVTCSKDGKMLEWYKGKN.SDGKKKPIGSFPLNKITSIRTKVDNLKSLEISVSSVHISTYLFTFKTRE ------120-------130 ERESWQNNLESFRKIMSMK ||||||||||||||||||| ERESWQNNLESFRKIMSMK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
110 | ARG | HH21 | 7.147 |
110 | ARG | HH22 | 7.147 |
124 | ARG | HH11 | 7.688 |
124 | ARG | HH12 | 7.688 |
124 | ARG | HH21 | 7.565 |
124 | ARG | HH22 | 7.565 |
124 | ARG | NH1 | 91.684 |
124 | ARG | NH2 | 95.877 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 787 | 756 | 96.1 |
13C chemical shifts | 574 | 557 | 97.0 |
15N chemical shifts | 132 | 120 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 240 | 235 | 97.9 |
13C chemical shifts | 238 | 234 | 98.3 |
15N chemical shifts | 117 | 114 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 547 | 521 | 95.2 |
13C chemical shifts | 336 | 323 | 96.1 |
15N chemical shifts | 15 | 6 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 61 | 96.8 |
13C chemical shifts | 63 | 60 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 49 | 92.5 |
13C chemical shifts | 51 | 43 | 84.3 |
15N chemical shifts | 2 | 2 | 100.0 |