Solution NMR structure of Pseudomonas aeruginosa TonB CTD
SHMGSLNDSD IKPLRMDPPV YPRMAQARGI EGRVKVLFTI TSDGRIDDIQ VLESVPSRMF DREVRQAMAK WRFEPRVSGG KIVARQATKM FFFKIEKRR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.3 % (1156 of 1201) | 96.9 % (618 of 638) | 95.0 % (441 of 464) | 98.0 % (97 of 99) |
Backbone | 98.1 % (571 of 582) | 98.5 % (195 of 198) | 97.9 % (285 of 291) | 97.8 % (91 of 93) |
Sidechain | 95.1 % (677 of 712) | 96.1 % (423 of 440) | 93.2 % (248 of 266) | 100.0 % (6 of 6) |
Aromatic | 73.8 % (62 of 84) | 88.1 % (37 of 42) | 58.5 % (24 of 41) | 100.0 % (1 of 1) |
Methyl | 100.0 % (94 of 94) | 100.0 % (47 of 47) | 100.0 % (47 of 47) |
1. entity 1
SHMGSLNDSD IKPLRMDPPV YPRMAQARGI EGRVKVLFTI TSDGRIDDIQ VLESVPSRMF DREVRQAMAK WRFEPRVSGG KIVARQATKM FFFKIEKRRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | H2O | protons | 4.75 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 117.8 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | H2O | protons | 4.75 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 117.8 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | H2O | protons | 4.75 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 117.8 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | H2O | protons | 4.75 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 117.8 ppm | na | indirect | 1.0 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 1 mM [U-99% 13C; U-99% 15N] PaTonB96, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaTonB96 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaPO4 buffer | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_34235_6fip.nef |
Input source #2: Coordindates | 6fip.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- SHMGSLNDSDIKPLRMDPPVYPRMAQARGIEGRVKVLFTITSDGRIDDIQVLESVPSRMFDREVRQAMAKWRFEPRVSGGKIVARQATKMFFFKIEKRR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMGSLNDSDIKPLRMDPPVYPRMAQARGIEGRVKVLFTITSDGRIDDIQVLESVPSRMFDREVRQAMAKWRFEPRVSGGKIVARQATKMFFFKIEKRR --------10--------20--------30--------40--------50--------60--------70--------80--------90---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_34235_6fip.nef
Assigned chemical shifts
----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- SHMGSLNDSDIKPLRMDPPVYPRMAQARGIEGRVKVLFTITSDGRIDDIQVLESVPSRMFDREVRQAMAKWRFEPRVSGGKIVARQATKMFFFKIEKRR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .HMGSLNDSDIKPLRMDPPVYPRMAQARGIEGRVKVLFTITSDGRIDDIQVLESVPSRMFDREVRQAMAKWRFEPRVSGGKIVARQATKMFFFKIEKRR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 638 | 615 | 96.4 |
13C chemical shifts | 464 | 438 | 94.4 |
15N chemical shifts | 112 | 102 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 198 | 195 | 98.5 |
13C chemical shifts | 198 | 193 | 97.5 |
15N chemical shifts | 93 | 91 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 440 | 420 | 95.5 |
13C chemical shifts | 266 | 245 | 92.1 |
15N chemical shifts | 19 | 11 | 57.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 53 | 100.0 |
13C chemical shifts | 53 | 53 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 34 | 81.0 |
13C chemical shifts | 41 | 21 | 51.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- SHMGSLNDSDIKPLRMDPPVYPRMAQARGIEGRVKVLFTITSDGRIDDIQVLESVPSRMFDREVRQAMAKWRFEPRVSGGKIVARQATKMFFFKIEKRR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .HMGSLNDSDIKPLRMDPPVYPRMAQARGIEGRVKVLFTITSDGRIDDIQVLESVPSRMFDREVRQAMAKWRFEPRVSGGKIVARQATKMFFFKIEKRR