Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Sequence alignments

• Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60----
GAMEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNERAKIKKSGS
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GAMEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNERAKIKKSGS

Chain assignments

Content subtype: combined_34240_6fvc.nef

Assigned chemical shifts

1. Saveframe: assigned_chemical_shifts_1
   • Status: Warning
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 64, Sequence coverage: 95.3%

     --------10--------20--------30--------40--------50--------60----
     GAMEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNERAKIKKSGS
      |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  
     .AMEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNERAKIKKS  
     --------10--------20--------30--------40--------50--------60--  
     

   • Total number of assignments
     • ¹H chemical shifts: 416
   • Completeness of assignments
     • Entity_assemble_ID: A
       • Excluded Atom_ID in statistics

         Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
         18	ARG	HH11	7.043
         18	ARG	HH21	6.438
         18	ARG	HH22	7.022
         33	ARG	HH11	7.045
         33	ARG	HH21	6.978
         56	ARG	HH11	7.337
         56	ARG	HH21	6.843

       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	431	409	94.9

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	130	122	93.8

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	301	287	95.3

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	26	25	96.2

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	25	25	100.0

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: A

Distance restraints

1. Saveframe: DYANA/DIANA_distance_constraints_2
   • Status: Warning
   • Experiment type: noe
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 64, Sequence coverage: 95.3%

     --------10--------20--------30--------40--------50--------60----
     GAMEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNERAKIKKSGS
      |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  
     .AMEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNERAKIKKS  
     --------10--------20--------30--------40--------50--------60--  
     

   • Total number of restraints: 2808
     • Intra-residue restraints, i = j : 707
     • Sequential restraints, | i - j | = 1 : 600
       • Backbone-backbone: 100
       • Backbone-side chain: 371
       • Side chain-side chain: 129
     • Medium range restraints, 1 < | i - j | < 5 : 751
       • Backbone-backbone: 138
       • Backbone-side chain: 302
       • Side chain-side chain: 311
     • Long range restraints, | i - j | >= 5 : 750
   • Weight of restraints: 1.0 (2808)
     • Intra-residue restraints, i = j : 1.0 (707)
     • Sequential restraints, | i - j | = 1 : 1.0 (600)
       • Backbone-backbone: 1.0 (100)
       • Backbone-side chain: 1.0 (371)
       • Side chain-side chain: 1.0 (129)
     • Medium range restraints, 1 < | i - j | < 5 : 1.0 (751)
       • Backbone-backbone: 1.0 (138)
       • Backbone-side chain: 1.0 (302)
       • Side chain-side chain: 1.0 (311)
     • Long range restraints, | i - j | >= 5 : 1.0 (750)
   • Potential type of restraints: upper-bound-parabolic (2808)
     • Intra-residue restraints, i = j : upper-bound-parabolic (707)
     • Sequential restraints, | i - j | = 1 : upper-bound-parabolic (600)
       • Backbone-backbone: upper-bound-parabolic (100)
       • Backbone-side chain: upper-bound-parabolic (371)
       • Side chain-side chain: upper-bound-parabolic (129)
     • Medium range restraints, 1 < | i - j | < 5 : upper-bound-parabolic (751)
       • Backbone-backbone: upper-bound-parabolic (138)
       • Backbone-side chain: upper-bound-parabolic (302)
       • Side chain-side chain: upper-bound-parabolic (311)
     • Long range restraints, | i - j | >= 5 : upper-bound-parabolic (750)
   • Range of distance target values: 2.42, 5.5 (Å)
   • Histogram of distance target values
   • Histogram of discrepancy in distance target values
   • Distance restraints per residue
     • Chain_ID: A
   • Distance restraints on contact map
     • Chain_ID_1: A - Chain_ID_2: A