Solution structure of the hazel allergen Cor a 1.0401
MGVFCYEDEA TSVIPPARLF KSFVLDADNL IPKVAPQHFT SAENLEGNGG PGTIKKITFA EGNEFKYMKH KVEEIDHANF KYCYSIIEGG PLGHTLEKIS YEIKMAAAPH GGGSILKITS KYHTKGNASI NEEEIKAGKE KAAGLFKAVE AYLLAHPDAY C
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.4 % (1475 of 1857) | 77.9 % (749 of 962) | 80.5 % (591 of 734) | 83.9 % (135 of 161) |
Backbone | 86.4 % (821 of 950) | 85.4 % (281 of 329) | 86.5 % (405 of 468) | 88.2 % (135 of 153) |
Sidechain | 74.5 % (784 of 1053) | 73.9 % (468 of 633) | 76.7 % (316 of 412) | 0.0 % (0 of 8) |
Aromatic | 40.7 % (70 of 172) | 55.8 % (48 of 86) | 25.6 % (22 of 86) | |
Methyl | 91.6 % (152 of 166) | 90.4 % (75 of 83) | 92.8 % (77 of 83) |
1. entity 1
MGVFCYEDEA TSVIPPARLF KSFVLDADNL IPKVAPQHFT SAENLEGNGG PGTIKKITFA EGNEFKYMKH KVEEIDHANF KYCYSIIEGG PLGHTLEKIS YEIKMAAAPH GGGSILKITS KYHTKGNASI NEEEIKAGKE KAAGLFKAVE AYLLAHPDAY CSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6 mM [U-13C; U-15N] Cor a 1.0401, 2 mM DTT, 10 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0401 | [U-13C; U-15N] | 0.6 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 10 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34281_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS ||||||||||||| ||||||||||||||||||| |||||||||||||||||| |||||||||||||||||||||| |||||||||| .GVFCYEDEATSVI.PARLFKSFVLDADNLIPKV......SAENLEGNGGPGTIKKIT.........MKHKVEEIDHANFKYCYSIIEG.PLGHTLEKIS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160- YEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAYC ||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| YEIKMAAAPHGGGSILKITSKYHTK.NASINEEEIKAGKEKAAGLFKAVEAYLLAHPDA -------110-------120-------130-------140-------150---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 962 | 738 | 76.7 |
13C chemical shifts | 734 | 572 | 77.9 |
15N chemical shifts | 162 | 127 | 78.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 329 | 275 | 83.6 |
13C chemical shifts | 322 | 259 | 80.4 |
15N chemical shifts | 153 | 127 | 83.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 633 | 463 | 73.1 |
13C chemical shifts | 412 | 313 | 76.0 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 86 | 79 | 91.9 |
13C chemical shifts | 86 | 81 | 94.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 86 | 46 | 53.5 |
13C chemical shifts | 86 | 20 | 23.3 |