Cadmium(II) form of shortened metallothionein from Pseudomonas fluorescens Q2-87 (residues: 1-52)
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | na | sing | 1:CYS7:SG | 2:CD1:CD |
2 | na | sing | 1:CYS32:SG | 2:CD1:CD |
3 | na | sing | 1:HIS36:NE2 | 2:CD1:CD |
4 | na | sing | 1:CYS49:SG | 2:CD1:CD |
5 | na | sing | 1:CYS10:SG | 2:CD1:CD |
6 | na | sing | 1:CYS42:SG | 2:CD1:CD |
7 | na | sing | 1:CYS47:SG | 2:CD1:CD |
8 | na | sing | 1:CYS49:SG | 2:CD1:CD |
9 | na | sing | 1:CYS10:SG | 2:CD1:CD |
10 | na | sing | 1:CYS12:SG | 2:CD1:CD |
11 | na | sing | 1:CYS28:SG | 2:CD1:CD |
12 | na | sing | 1:CYS42:SG | 2:CD1:CD |
13 | na | sing | 1:CYS5:SG | 2:CD1:CD |
14 | na | sing | 1:CYS10:SG | 2:CD1:CD |
15 | na | sing | 1:CYS28:SG | 2:CD1:CD |
16 | na | sing | 1:CYS32:SG | 2:CD1:CD |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.8 % (522 of 545) | 96.2 % (277 of 288) | 97.6 % (201 of 206) | 86.3 % (44 of 51) |
Backbone | 94.3 % (283 of 300) | 93.1 % (94 of 101) | 98.0 % (150 of 153) | 84.8 % (39 of 46) |
Sidechain | 98.0 % (288 of 294) | 97.9 % (183 of 187) | 98.0 % (100 of 102) | 100.0 % (5 of 5) |
Aromatic | 91.2 % (31 of 34) | 94.1 % (16 of 17) | 88.2 % (15 of 17) | |
Methyl | 100.0 % (20 of 20) | 100.0 % (10 of 10) | 100.0 % (10 of 10) |
1. entity 1
NELRCGCPDC HCKVDPERVF NHDGEAYCSQ ACAEQHPNGE PCPAPDCHCE RSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 1.5 mM metallothionein, 6 mM U-113CD CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1.5 (±0.1) mM | |
6 | CADMIUM ION | U-113CD | 6 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker AvanceII - 500 MHz CRYO 5 mm QNP (1H,13C,31P,19F) with an actively shielded z-gradient coil and ATM
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 7.4 (±0.2), Details 1.5 mM metallothionein, 6 mM U-113CD CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1.5 (±0.1) mM | |
6 | CADMIUM ION | U-113CD | 6 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker AvanceII - 500 MHz CRYO 5 mm QNP (1H,13C,31P,19F) with an actively shielded z-gradient coil and ATM
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 7.4 (±0.2), Details 1.5 mM metallothionein, 6 mM U-113CD CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1.5 (±0.1) mM | |
6 | CADMIUM ION | U-113CD | 6 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34288_6gv6.nef |
Input source #2: Coordindates | 6gv6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:5:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:7:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:12:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:28:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:28:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:32:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:32:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:36:HIS:NE2 | 2:1:CD:CD | unknown | unknown | n/a |
1:42:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:42:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:47:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:49:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:49:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CD | CADMIUM ION | None |
B | 2 | CD | CADMIUM ION | None |
B | 3 | CD | CADMIUM ION | None |
B | 4 | CD | CADMIUM ION | None |
Sequence alignments
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS |||||||||||||||||||||||||||||||||||||||||||||||||||| NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 52 | 0 | 0 | 100.0 |
Content subtype: combined_34288_6gv6.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS |||||||||||||||||||||||||||||||||||||||||||||||||||| NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
11 | HIS | ND1 | 223.938 |
11 | HIS | NE2 | 176.415 |
22 | HIS | ND1 | 225.092 |
22 | HIS | NE2 | 176.702 |
36 | HIS | HD1 | 13.272 |
36 | HIS | ND1 | 173.798 |
36 | HIS | NE2 | 225.384 |
48 | HIS | ND1 | 191.628 |
48 | HIS | NE2 | 181.908 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 288 | 276 | 95.8 |
13C chemical shifts | 206 | 201 | 97.6 |
15N chemical shifts | 54 | 43 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 93 | 92.1 |
13C chemical shifts | 104 | 101 | 97.1 |
15N chemical shifts | 46 | 38 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 187 | 183 | 97.9 |
13C chemical shifts | 102 | 100 | 98.0 |
15N chemical shifts | 8 | 5 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 10 | 100.0 |
13C chemical shifts | 10 | 10 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 16 | 94.1 |
13C chemical shifts | 17 | 15 | 88.2 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS ||||||||||||||||||||||||||||||||||||||||||||||||||| .ELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS
Dihedral angle restraints
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS |||||||||| |||||||||||||||||||||||||||||||||||||| .ELRCGCPDCH.KVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCE --------10--------20--------30--------40--------50