Solution structure of the water-soluble LU-domain of human Lypd6 protein
MFKCFTCEKA ADNYECNRWA PDIYCPRETR YCYTQHTMEV TGNSISVTKR CVPLEECLST GCRDSEHEGH KVCTSCCEGN ICNLPLPRNE TDATFA
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | ammonium chloride | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | ammonium chloride | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | ammonium chloride | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | ammonium chloride | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Lypd6sh | [U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 800 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 13C; U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lypd6sh | [U-99% 13C; U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 800 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 13C; U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lypd6sh | [U-99% 13C; U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 600 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 13C; U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lypd6sh | [U-99% 13C; U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 600 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 13C; U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lypd6sh | [U-99% 13C; U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 600 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 13C; U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lypd6sh | [U-99% 13C; U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 600 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 13C; U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lypd6sh | [U-99% 13C; U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 600 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 13C; U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lypd6sh | [U-99% 13C; U-99% 15N] | 0.1 mM |
Bruker AvanceIII - 600 MHz with CryoProbe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.1), Details 0.1 mM [U-99% 15N] Lypd6sh, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Lypd6sh | [U-99% 15N] | 0.1 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34333_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
94 | THR | HG1 | 1.388 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 554 | 524 | 94.6 |
13C chemical shifts | 414 | 354 | 85.5 |
15N chemical shifts | 105 | 97 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 191 | 187 | 97.9 |
13C chemical shifts | 192 | 182 | 94.8 |
15N chemical shifts | 91 | 88 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 363 | 337 | 92.8 |
13C chemical shifts | 222 | 172 | 77.5 |
15N chemical shifts | 14 | 9 | 64.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 39 | 100.0 |
13C chemical shifts | 39 | 39 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 36 | 83.7 |
13C chemical shifts | 42 | 17 | 40.5 |
15N chemical shifts | 1 | 1 | 100.0 |