Solid-state NMR structure of outer membrane protein AlkL in DMPC lipid bilayers
MNENYPAKSA GYNQGDWVAS FNFSKVYVGE ELGDLNVGGG ALPNADVSIG NDTTLTFDIA YFVSSNIAVD FFVGVPARAK FQGEKSISSL GRVSEVDYGP AILSLQYHYD SFERLYPYVG VGVGRVLFFD KTDGALSSFD IKDKWAPAFQ VGLRYDLGNS WMLNSDVRYI PFKTDVTGTL GPVPVSTKIE VDPFILSLGA SYVFKLAAAL EHHHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 60.5 % (1516 of 2507) | 56.7 % (725 of 1278) | 61.3 % (615 of 1003) | 77.9 % (176 of 226) |
Backbone | 79.1 % (1024 of 1294) | 77.7 % (349 of 449) | 78.9 % (502 of 636) | 82.8 % (173 of 209) |
Sidechain | 45.6 % (644 of 1411) | 45.4 % (376 of 829) | 46.9 % (265 of 565) | 17.6 % (3 of 17) |
Aromatic | 2.2 % (7 of 318) | 3.1 % (5 of 159) | 1.3 % (2 of 156) | 0.0 % (0 of 3) |
Methyl | 56.1 % (138 of 246) | 55.3 % (68 of 123) | 56.9 % (70 of 123) |
1. entity 1
MNENYPAKSA GYNQGDWVAS FNFSKVYVGE ELGDLNVGGG ALPNADVSIG NDTTLTFDIA YFVSSNIAVD FFVGVPARAK FQGEKSISSL GRVSEVDYGP AILSLQYHYD SFERLYPYVG VGVGRVLFFD KTDGALSSFD IKDKWAPAFQ VGLRYDLGNS WMLNSDVRYI PFKTDVTGTL GPVPVSTKIE VDPFILSLGA SYVFKLAAAL EHHHHHHHHSolvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N; U-2H] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Outer membrane protein AlkL | [U-13C; U-15N; U-2H] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - 800 MHz 1.3 mm Rotor 60 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N; U-2H] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Outer membrane protein AlkL | [U-13C; U-15N; U-2H] | 0.5 w/w |
Bruker AVANCE III - 800 MHz 1.3 mm Rotor 60 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N; U-2H] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Outer membrane protein AlkL | [U-13C; U-15N; U-2H] | 0.5 w/w |
Bruker AVANCE III - 800 MHz 1.3 mm Rotor 60 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N; U-2H] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Outer membrane protein AlkL | [U-13C; U-15N; U-2H] | 0.5 w/w |
Bruker AVANCE III - 800 MHz 1.3 mm Rotor 60 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N; U-2H] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Outer membrane protein AlkL | [U-13C; U-15N; U-2H] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - na MHz 0.7 mm Rotor 111 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Outer membrane protein AlkL | [U-13C; U-15N] | 0.5 w/w |
Bruker AVANCE III - 800 MHz 1.3 mm Rotor 60 kHz MAS
State isotropic, Solvent system Water, Pressure 1 atm, Temperature 303 K, pH 7, Details 0.5 w/w [U-13C; U-15N; U-2H] Outer membrane protein AlkL, Water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Outer membrane protein AlkL | [U-13C; U-15N; U-2H] | 0.5 w/w |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34365_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNENYPAKSAGYNQGDWVASFNFSKVYVGEELGDLNVGGGALPNADVSIGNDTTLTFDIAYFVSSNIAVDFFVGVPARAKFQGEKSISSLGRVSEVDYGP |||||||||||||||||||||||| ||||| ||||| ||||||||||||||||||||||||||||||||||||||||||||||| ..........GYNQGDWVASFNFSKVYVGEELGD..VGGGA...ADVSI....TLTFDIAYFVSSNIAVDFFVGVPARAKFQGEKSISSLGRVSEVDYGP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 AILSLQYHYDSFERLYPYVGVGVGRVLFFDKTDGALSSFDIKDKWAPAFQVGLRYDLGNSWMLNSDVRYIPFKTDVTGTLGPVPVSTKIEVDPFILSLGA ||||||||| |||||||||||||||||||||||||||||||||||||||||||| ||||||||| ||||||||||||||||||||| |||||||| AILSLQYHY.....LYPYVGVGVGRVLFFDKTDGALSSFDIKDKWAPAFQVGLRYDLG..WMLNSDVRY.PFKTDVTGTLGPVPVSTKIEV.PFILSLGA -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 -------210--------- SYVFKLAAALEHHHHHHHH |||| SYVF ----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
106 | GLN | CD | 179.863 |
108 | HIS | HD1 | 9.707 |
108 | HIS | ND1 | 162.828 |
147 | PRO | N | 133.328 |
164 | ASN | CG | 179.988 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 1003 | 589 | 58.7 |
1H chemical shifts | 1278 | 687 | 53.8 |
15N chemical shifts | 232 | 170 | 73.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 438 | 340 | 77.6 |
1H chemical shifts | 449 | 338 | 75.3 |
15N chemical shifts | 209 | 165 | 78.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 565 | 249 | 44.1 |
1H chemical shifts | 829 | 349 | 42.1 |
15N chemical shifts | 23 | 5 | 21.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 125 | 62 | 49.6 |
1H chemical shifts | 125 | 58 | 46.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 156 | 0 | 0.0 |
1H chemical shifts | 159 | 1 | 0.6 |
15N chemical shifts | 3 | 0 | 0.0 |