Solution Structure of ribosome-binding factor A (RbfA) under physiological conditions
SAKEFGRPQR VAQEMQKEIA LILQREIKDP RLGMMTTVSG VEMSRDLAYA KVYVTFLNDK DEDAVKAGIK ALQEASGFIR SLLGKAMRLR IVPELTFFYD NSLVEGMRMS NLVTSVVKHD EERRVNPDDS KEDALEVLFQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.7 % (1399 of 1652) | 83.5 % (722 of 865) | 86.3 % (553 of 641) | 84.9 % (124 of 146) |
Backbone | 90.5 % (753 of 832) | 90.1 % (255 of 283) | 91.8 % (379 of 413) | 87.5 % (119 of 136) |
Sidechain | 81.0 % (772 of 953) | 80.2 % (467 of 582) | 83.1 % (300 of 361) | 50.0 % (5 of 10) |
Aromatic | 15.9 % (14 of 88) | 22.7 % (10 of 44) | 9.1 % (4 of 44) | |
Methyl | 97.0 % (159 of 164) | 93.9 % (77 of 82) | 100.0 % (82 of 82) |
1. entity 1
SAKEFGRPQR VAQEMQKEIA LILQREIKDP RLGMMTTVSG VEMSRDLAYA KVYVTFLNDK DEDAVKAGIK ALQEASGFIR SLLGKAMRLR IVPELTFFYD NSLVEGMRMS NLVTSVVKHD EERRVNPDDS KEDALEVLFQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.6, Details 400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RbfA | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Properties
Input source #1: Assigned chemical shifts - Assigned chemical shifts | bmr34385_3.str |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | OK |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34385_3.str
# | Content subtype | Saveframe | Status | # of rows | Experiment type | Sequence coverage (%) |
---|---|---|---|---|---|---|
1 | Assigned chemical shifts | assigned_chemical_shifts_1 | OK | 1472 | 90.7 (chain: 1, length: 140) | |
1 | Chemical shift references | chem_shift_reference_1 | OK | 3 | No information |
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYD | | |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....G.P.RVAQEMQKEIALILQREIKDPRLG..TTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYD -------110-------120-------130-------140 NSLVEGMRMSNLVTSVVKHDEERRVNPDDSKEDALEVLFQ ||||||| |||||||| ||||||||||||||||||||| NSLVEGM...NLVTSVVK.DEERRVNPDDSKEDALEVLFQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 865 | 684 | 79.1 |
13C chemical shifts | 641 | 522 | 81.4 |
15N chemical shifts | 157 | 114 | 72.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 242 | 85.5 |
13C chemical shifts | 280 | 237 | 84.6 |
15N chemical shifts | 136 | 109 | 80.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 582 | 442 | 75.9 |
13C chemical shifts | 361 | 285 | 78.9 |
15N chemical shifts | 21 | 5 | 23.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 76 | 85.4 |
13C chemical shifts | 89 | 84 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 7 | 15.9 |
13C chemical shifts | 44 | 0 | 0.0 |